ATLPC0028851
ATLPC0028851
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
- Length37 aa
- Monoisotopic mass3921.0 Da
- Net charge @ pH 7.43.00
- Isoelectric point9.54
- GRAVY-0.249
- Measurements9
- Endpoints1
- Domains1/5
- Products—
- No matrix stability evidence
- No clearance evidence
- No immunogenicity context
- 3 liability motifs
Open the matching evidence section below
Sequence & molecular identity
1 formsReviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.
Sequence & peptidoform
Identity summaryCanonical sequence only
- Identity status
- Canonical sequence only
- Residues
- 37
- Peptidoform features
- 0
- Documented molecular forms
- 1
- Representations
- 2
Documented molecular forms1 form linked to this peptide identity
| Form | Topology | Modifications | Connections | Representations | Measurements | |
|---|---|---|---|---|---|---|
| ATLPF0031333 | — | — | — | Notation only | — |
Residue view
Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.
Features are shown only when a reported notation or topology record supports them.
Structure & chemistry
Chemical representationsequence / HELM only
How the current release can interpret this identity chemically.
plain sequence-likeResidue string used for positional interpretation when available.
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
3D structure references2 references
Covalent topology & modificationsnone
No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.
Physicochemical profile
4 descriptorsComputed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.
Core descriptors37 aa · pI 9.5 · GRAVY -0.25
- Length
- 37 aa
- Monoisotopic mass
- 3920.96 Da
- Average mass
- 3923.43 Da
- Net charge at pH 7.4
- 3.00
- Estimated pI
- 9.54
- GRAVY
- -0.249
- KD-positive residues
- 35.1%
- Aromatic residues
- 5.4%
Developability interpretation
- Ionization context
- pH 7.4 separated from pI
- Hydrophobicity balance
- Leans hydrophilic
- Amphipathic moment (μH)
- 0.81
- Computation boundary
- Standard-sequence only
Charge & residue composition
Modeled net charge across common formulation and assay pH checkpoints.
Grouped composition is often more interpretable than a long amino-acid list.
Hydropathy & amphipathic windows
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Sequence-liability cues
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Alpha-helix amphipathic projection
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
Method notes
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.
Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.
At or below 40 — predicted stable in vitro.
A280 (1 g/L) ≈ 0.38 · 1,615 M⁻¹·cm⁻¹ with 1 disulfide
Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.
Distribution / Barrier
9 recordsWhat is known about distribution, binding, permeability, or barrier crossing?
Evidence interpretation
Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
BBB penetration9 records · 3 matched-context · 6 as reported · 0 context only · 0 review required
| # | Value | Analysis use | Assay / model | Result context | Reference |
|---|---|---|---|---|---|
| 1 | 2 % | Eligible when experimental context matches | Capillary depletion · blood-brain barrier | Result: Reported point value · Molecular form: not reported · % capillary · non saturable · Source: Primary reference linked | Reference |
| 2 | 98 % | Eligible when experimental context matches | Capillary depletion · blood-brain barrier | Result: Reported point value · Molecular form: not reported · % parenchyma · non saturable · Source: Primary reference linked | Reference |
| 3 | 0.12 %/g | Eligible when experimental context matches | Intravenous injection (multiple time regression) · blood-brain barrier | Result: Reported point value · Molecular form: not reported · % injected dose · non saturable · Source: Primary reference linked | Reference |
| 4 | 8.99 x 10^-4 mL/g/min | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Result: Reported point value · Molecular form: not reported · Kin · non saturable · Source: Primary reference linked | Reference |
| 5 | 9.54 x 10^-4 mL/g/min | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Result: Reported point value · Molecular form: not reported · Kin · non saturable · Source: Primary reference linked | Reference |
| 6 | 0.0121 mL/g | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Result: Reported point value · Molecular form: not reported · Vi · non saturable · Source: Primary reference linked | Reference |
| 7 | 0.0099 mL/g | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Result: Reported point value · Molecular form: not reported · Vi · non saturable · Source: Primary reference linked | Reference |
| 8 | 23 % | Interpret as reported | Not specified | Result: Reported point value · Molecular form: not reported · Source: Primary reference linked | Reference |
| 9 | Observation source reported BBB observation | Interpret as reported | Not specified | Result: Qualitative or narrative result · Molecular form: not reported · Source: Primary reference linked | Source record |
Barrier and permeability assay context
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
cell monolayer
barrier evidence
Evidence landscape
9 recordsCross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.
A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.
Top evidence-bearing endpoint questions.
Broad context buckets, useful before comparing values.
Reference-link availability for measurement-level audit.
Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.
| # | ADMET domain | Endpoint | Reported value | Result type | Analysis use | Assay / model | Condition | Reference |
|---|---|---|---|---|---|---|---|---|
| 1 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | Observation source reported BBB observation | Qualitative or narrative result | Interpret as reported | Not specified | Not specified | Source record Primary reference linked |
| 2 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 23 % | Reported point value | Interpret as reported | Not specified | Not specified | Reference Primary reference linked |
| 3 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 98 % | Reported point value | Eligible when experimental context matches | Capillary depletion · blood-brain barrier | Not specified | Reference Primary reference linked |
| 4 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 2 % | Reported point value | Eligible when experimental context matches | Capillary depletion · blood-brain barrier | Not specified | Reference Primary reference linked |
| 5 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 0.012 mL/g | Reported point value | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Not specified | Reference Primary reference linked |
| 6 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 8.99 x 10^-4 mL/g/min | Reported point value | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Not specified | Reference Primary reference linked |
| 7 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 0.12 %/g | Reported point value | Eligible when experimental context matches | Intravenous injection (multiple time regression) · blood-brain barrier | Not specified | Reference Primary reference linked |
| 8 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 9.54 x 10^-4 mL/g/min | Reported point value | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Not specified | Reference Primary reference linked |
| 9 | Distribution / Barrier Distribution | Blood Brain Barrier Penetration | 0.01 mL/g | Reported point value | Interpret as reported | Intravenous injection (multiple time regression) · blood-brain barrier | Not specified | Reference Primary reference linked |
Product context
Product-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.
This peptide is currently interpreted from sequence, structure, physicochemical, and ADMET evidence only.
Identity & reference map
9 sourcesReference-level support for checking reported names, sequence notation, and peptide identity agreement.
Summary4 reference groups
- Identity type
- canonical sequence
- Reported notation
- 1
- Reference groups
- 4
- Measurements
- 9
- ATL peptide ID
- ATLPC0028851
Identity concordance
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
Reference map4 reference groups
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
Reference | Distribution Blood Brain Barrier Penetration | brainpeps_observation_v2_27_2_2_488bb8c381c9cbacbbba, brainpeps_observation_v2_27_2_36_30fa1ee6b741bfc7b0bd KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYexact | 4 identity 4 evidence |
Reference | Distribution Blood Brain Barrier Penetration | brainpeps_observation_v2_27_2_2_a4912314a90ae041df45, brainpeps_observation_v2_27_2_36_fe2acfc0e90734de18ec KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYexact | 3 identity 3 evidence |
Reference | Distribution Blood Brain Barrier Penetration | No reported alias | 1 identity 1 evidence |
Source record | Distribution Blood Brain Barrier Penetration | No reported alias | 1 identity 1 evidence |
Data access & reproducibility
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Record scopePublic release
- ATL peptide ID
- ATLPC0028851
- Identity type
- canonical sequence
- ADMET endpoints
- 1
- Evidence records
- 9
- Reference groups
- 4
- Release view
- Public release
Data access
Structured peptide profile
JSONPeptide-specific profile used by this page, including identity and evidence context.
Peptide catalogue
TSVComplete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.
Measurement catalogue
TSVComplete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.
Programmatic access
The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0028851' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'