Semaglutide
ATLPC0033167
H-Aib-EGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
- Length35 aa
ATLPC0033167
H-Aib-EGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
How stable is the peptide in biological matrices or protease systems?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
Can basic developability descriptors be computed?
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
What evidence describes clearance or persistence?
What safety, toxicity, or tolerability evidence is attached?
Reported sequence notation was converted to parent-residue display for visualization; the original notation remains shown below.
Features are shown only when a reported notation or topology record supports them.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
Reported token b is not one of the 20 standard residue symbols in this display.
Normalized for positional visualization, not a replacement for the reported modified notation.
HAIXEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Original notation retained for interpretation and comparison.
H-Aib-EGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
HAIXEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRGPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Serum/plasma stability and protease stability evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 165 hours 594000 seconds | Comparable | ELISA, LC/MS · human · (Dose s/c injected)Human plasma | Dose/window: 1 -2 nmol/Kg · Time: Blood samples collected upto 96 hous · Proteases from Human plasma · in vivo | Open |
| 2 | 46 hours 165600 seconds | Comparable | ELISA, LC/MS · porcine · (Dose i/v injected)Mini-pigs plasma | Dose/window: 5nmol/Kg · Time: Blood samples collected upto 96 hous · Proteases from mini-pig plasma · in vivo | Open |
Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
The identity reference does not expose a sequence string.
H-Aib-EGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
H-Aib-EGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
PubMed 26308095 | Stability Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEEFIIAWLVKGRGexact | 2 identity 2 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0033167' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.