Skip to content
ADMETatlas
peptide evidence atlas
Home
About
Home

Browse

PeptidesProductsEvidenceContext signalsDescriptors

Developability

ProfileComparator

Resources

ManualExplanationsStatisticsDownloadLicenseAbout
  1. Home
  2. Peptides
  3. ATLPC0000948
Peptide·plain sequence-like

ATLPC0000948

ATLPC0000948

MKGSWWRRVAMIALSAGLLAGSLSMGTGIRKADAAAGNQNYAEALQKAIYFYEAQRSGPLPASNRVEWRGNSGIQDGADV…

Compare in workbenchDownload releaseAPI JSON
  • Length
    997 aa
  • Monoisotopic mass
    106905.8 Da
  • Net charge @ pH 7.4
    -19.60
  • Isoelectric point
    5.02
  • GRAVY
    -0.306
On this page
  • 01 Sequence & molecular identity
  • 02 Physicochemical profile
  • 03 Excretion / Persistence
  • 04 Evidence landscape
  • 05 Product context
  • 06 Identity & reference map
  • 07 Data access & reproducibility
Coveragecounts only · not riskATLPC0000948
  • Measurements
    1
  • Endpoints
    1
  • Domains
    1/5
  • Products
    —
  • No matrix stability evidence
  • 1 clearance measurement
  • No immunogenicity context
  • 4 liability motifs
Jump to domain

Open the matching evidence section below

All evidence index · 1
Exposure / Absorption
No evidence
Distribution / Barrier
No evidence
Metabolic & Proteolytic Stability
No evidence
Excretion / Persistence
1 measurement
Toxicity / Safety
No evidence
01

Sequence & molecular identity

1 forms

Reviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.

Sequence & peptidoform

·
Identity summaryCanonical sequence only
Identity status
Canonical sequence only
Residues
997
Peptidoform features
0
Documented molecular forms
1
Representations
2
Documented molecular forms1 form linked to this peptide identity
FormTopologyModificationsConnectionsRepresentationsMeasurements
ATLPF0001054———Notation only1
Residue view
Residue display
997 residues
M1K2G3S4W5W6R7R8V9A10M11I12A13L14S15A16G17L18L19A20G21S22L23S24M25G26T27G28I29R30K31A32D33A34A35A36G37N38Q39N40Y41A42E43A44L45Q46K47A48I49Y50F51Y52E53A54Q55R56S57G58P59L60P61A62S63N64R65V66E67W68R69G70N71S72G73I74Q75D76G77A78D79V80G81V82D83L84T85G86G87W88Y89D90A91G92D93H94V95K96F97G98F99P100M101A102A103S104A105T106M107L108A109W110S111V112V113E114Y115S116D117G118Y119E120Q121A122G123Q124L125E126E127I128K129D130N131I132R133W134A135T136D137Y138F139M140K141A142H143T144K145P146N147E148L149W150G151Q152V153G154A155G156N157T158D159H160A161W162W163G164P165A166E167V168M169Q170M171N172R173P174S175F176K177I178D179A180S181C182P183G184S185D186L187A188A189E190T191A192A193A194L195A196A197S198S199I200V201F202A203D204D205D206P207A208Y209S210A211R212L213L214Q215H216A217K218E219L220Y221N222F223A224Y225T226Y227R228G229E230Y231T232D233C234I235T236D237A238A239A240F241Y242N243S244W245T246G247Y248E249D250E251L252A253W254G255G256A257W258L259Y260L261A262T263N264D265S266A267Y268L269S270K271A272I273A274A275T276D277R278W279S280S281S282G283G284S285A286N287W288P289Y290T291W292T293Q294G295W296D297S298K299H300Y301G302A303Q304I305L306L307A308R309I310T311S312S313L314N315M316P317E318A319T320R321F322I323Q324S325T326E327R328N329L330D331Y332W333T334V335G336V337N338G339T340R341V342K343Y344T345P346G347G348L349A350W351L352D353Q354W355G356S357L358R359Y360A361A362N363A364S365F366I367S368F369V370Y371S372D373W374V375S376D377P378V379K380K381S382R383Y384Q385D386F387A388V389S390Q391M392N393Y394I395L396G397D398N399P400R401Q402S403S404Y405V406V407G408Y409G410Q411N412A413P414Q415H416P417H418H419R420T421A422H423G424S425W426L427N428N429E430D431I432P433A434N435H436R437H438I439L440Y441G442A443M444V445G446G447P448D449A450S451D452G453Y454T455D456D457I458G459D460Y461V462S463N464E465V466A467T468D469Y470N471A472G473F474T475G476A477L478A479K480M481N482L483L484F485G486Q487N488H489Q490P491L492A493N494F495P496A497P498E499V500K501G502D503E504F505F506V507E508A509A510I511K512S513S514G515A516N517Y518T519E520I521R522A523Q524L525N526N527R528S529A530W531P532A533R534M535G536D537Q538L539S540F541K542Y543F544L545D546L547S548E549V550Y551A552A553G554R555T556V557S558D559V560Q561V562T563T564S565Y566T567E568G569A570T571V572S573Q574P575V576V577V578N579A580A581Q582H583I584Y585A586I587T588A589N590F591G592N593T594K595I596Y597P598G599G600E601G602N603Y604R605K606E607V608Q609F610R611I612T613G614P615Q616G617A618W619N620A621S622N623D624H625S626F627Q628T629L630T631T632G633T634P635V636K637S638I639Y640L641P642V643Y644D645A646G647V648K649V650Y651G652Q653E654P655G656L657T658P659V660T661V662P663G664A665P666A667G668V669Q670A671V672A673G674S675S676Q677V678N679L680T681W682A683A684V685S686G687A688E689S690Y691T692V693K694R695S696E697V698S699G700G701P702Y703T704T705V706A707T708G709V710N711G712L713T714Y715T716N717T718G719L720T721N722G723T724T725Y726Y727Y728V729V730T731A732V733N734S735A736G737E738S739S740G741S742V743Q744V745S746A747T748P749Q750A751A752S753T754V755P756G757A758L759T760L761S762G763T764A765G766N767A768Q769S770V771L772T773W774T775T776A777S778G779A780T781T782Y783K784V785Q786R787S788V789A790G791G792T793Y794A795D796V797A798T799G800L801S802V803L804T805Y806T807D808T809T810A811L812N813G814T815T816Y817N818Y819R820I821A822A823V824N825A826N827G828Q829T830L831S832N833V834L835A836L837T838P839S840A841P842P843V844T845T846G847T848L849E850V851Q852Y853R854S855G856G857S858G859N860S861S862N863A864A865T866P867Q868F869N870V871K872N873T874G875T876Q877A878I879D880L881S882T883V884K885I886R887Y888Y889F890T891K892D893G894A895D896Q897M898T899F900W901C902D903Y904A905E906M907G908T909A910N911V912E913G914T915F916V917T918V919N920P921A922K923G924T925A926D927T928Y929L930E931I932S933F934K935S936G937A938G939S940L941A942A943G944A945E946T947G948V949I950Q951A952R953F954S955K956N957N958W959S960N961F962D963L964S965N966D967Y968S969Y970D971A972S973K974T975A976F977A978A979W980N981K982V983T984G985Y986Q987G988N989T990K991V992W993G994L995E996P997
Side-chain classNonpolarPolarBasic (+)Acidic (−)Modified

Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.

Peptidoform features

Features are shown only when a reported notation or topology record supports them.

No terminal modification, residue-level marker, disulfide, staple, coordination, or other topology signal is currently available.

Structure & chemistry

·
Chemical representationsequence / HELM only
Representation class

How the current release can interpret this identity chemically.

plain sequence-like
Parent-residue sequence

Residue string used for positional interpretation when available.

MKGSWWRRVAMIALSAGLLAGSLSMGTGIRKADAAAGNQNYAEALQKAIYFYEAQRSGPLPASNRVEWRGNSGIQDGADVGVDLTGGWYDAGDHVKFGFPMAASATMLAWSVVEYSDGYEQAGQLEEIKDNIRWATDYFMKAHTKPNELWGQVGAGNTDHAWWGPAEVMQMNRPSFKIDASCPGSDLAAETAAALAASSIVFADDDPAYSARLLQHAKELYNFAYTYRGEYTDCITDAAAFYNSWTGYEDELAWGGAWLYLATNDSAYLSKAIAATDRWSSSGGSANWPYTWTQGWDSKHYGAQILLARITSSLNMPEATRFIQSTERNLDYWTVGVNGTRVKYTPGGLAWLDQWGSLRYAANASFISFVYSDWVSDPVKKSRYQDFAVSQMNYILGDNPRQSSYVVGYGQNAPQHPHHRTAHGSWLNNEDIPANHRHILYGAMVGGPDASDGYTDDIGDYVSNEVATDYNAGFTGALAKMNLLFGQNHQPLANFPAPEVKGDEFFVEAAIKSSGANYTEIRAQLNNRSAWPARMGDQLSFKYFLDLSEVYAAGRTVSDVQVTTSYTEGATVSQPVVVNAAQHIYAITANFGNTKIYPGGEGNYRKEVQFRITGPQGAWNASNDHSFQTLTTGTPVKSIYLPVYDAGVKVYGQEPGLTPVTVPGAPAGVQAVAGSSQVNLTWAAVSGAESYTVKRSEVSGGPYTTVATGVNGLTYTNTGLTNGTTYYYVVTAVNSAGESSGSVQVSATPQAASTVPGALTLSGTAGNAQSVLTWTTASGATTYKVQRSVAGGTYADVATGLSVLTYTDTTALNGTTYNYRIAAVNANGQTLSNVLALTPSAPPVTTGTLEVQYRSGGSGNSSNAATPQFNVKNTGTQAIDLSTVKIRYYFTKDGADQMTFWCDYAEMGTANVEGTFVTVNPAKGTADTYLEISFKSGAGSLAAGAETGVIQARFSKNNWSNFDLSNDYSYDASKTAFAAWNKVTGYQGNTKVWGLEP
HELM

Polymer notation for modified peptide representation when available.

Not available
SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available
No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure referencesnone attached
3D structure not available

A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.

Covalent topology & modificationsnone
Exact topology not established

No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.

02

Physicochemical profile

4 descriptors

Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.

·
Core descriptors997 aa · pI 5.0 · GRAVY -0.31
Length
997 aa
Monoisotopic mass
106905.79 Da
Average mass
106971.96 Da
Net charge at pH 7.4
-19.60
Estimated pI
5.02
GRAVY
-0.306
KD-positive residues
33.5%
Aromatic residues
11.8%
Developability interpretation
Ionization context
pH 7.4 separated from pI
Hydrophobicity balance
Leans hydrophilic
Amphipathic moment (μH)
0.05
Computation boundary
Standard-sequence only
Charge & residue composition
pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2
79.07
pH 5
0.31
pH 6
-9.54
pH 7.4
-19.81
pH 9
-28.82
pH 12
-121.99
Residue-class composition

Grouped composition is often more interpretable than a long amino-acid list.

Acidic (D,E)
86 · 8.6%
Basic (K,R,H)
79 · 7.9%
Polar uncharged (N,Q,S,T)
272 · 27.3%
Hydrophobic aliphatic (A,V,I,L,M)
301 · 30.2%
Aromatic (F,W,Y)
118 · 11.8%
Conformational / sulfur (G,P,C)
141 · 14.1%
Top residues
A12812.8%G999.9%T898.9%S828.2%V707.0%N595.9%Y595.9%L585.8%
Hydropathy & amphipathic windows
Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window
9-15
VAMIALS
GRAVY 2.457
Most hydrophilic window
380-386
KKSRYQD
GRAVY -3.057
991 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.
Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

12 aa window
126-137
EEIKDNIRWATD
μH 1.93 · charge -2.0
15 aa window
125-139
LEEIKDNIRWATDYF
μH 1.89 · charge -2.0
12 aa window
125-136
LEEIKDNIRWAT
μH 1.84 · charge -1.0
18 aa window
125-142
LEEIKDNIRWATDYFMKA
μH 1.81 · charge -1.0
12 aa window
128-139
IKDNIRWATDYF
μH 1.80 · charge 0.0
Sequence-liability cues
Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Asn deamidation motif
NG, NS, NT · pos 71, 157, 243, 338, 593, 711 +8
Asn followed by small/polar residues is a known sequence context to review for deamidation susceptibility.
Asp isomerization motif
DG, DP, DS, DT · pos 76, 117, 206, 265, 297, 377 +4
Asp-containing motifs can merit review for isomerization or related degradation pathways.
Oxidation-sensitive residues
M, W, C · pos 1, 5, 6, 11, 25, 68 +41
Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.
Cys covalent complexity
C · pos 182, 234, 902
Multiple cysteines can indicate disulfide or free-thiol interpretation requirements.
Alpha-helix amphipathic projection
Helical wheel · Edmundson projection
μH = 0.05100°/residue · 997 aa
μH1: M (Met) · Hydrophobic · K-D 1.9M12: K (Lys) · Basic + · K-D -3.9K3: G (Gly) · Special · K-D -0.4G4: S (Ser) · Polar · K-D -0.8S5: W (Trp) · Aromatic · K-D -0.9W56: W (Trp) · Aromatic · K-D -0.9W7: R (Arg) · Basic + · K-D -4.5R8: R (Arg) · Basic + · K-D -4.5R9: V (Val) · Hydrophobic · K-D 4.2V10: A (Ala) · Hydrophobic · K-D 1.8A1011: M (Met) · Hydrophobic · K-D 1.9M12: I (Ile) · Hydrophobic · K-D 4.5I13: A (Ala) · Hydrophobic · K-D 1.8A14: L (Leu) · Hydrophobic · K-D 3.8L15: S (Ser) · Polar · K-D -0.8S1516: A (Ala) · Hydrophobic · K-D 1.8A17: G (Gly) · Special · K-D -0.4G18: L (Leu) · Hydrophobic · K-D 3.8L19: L (Leu) · Hydrophobic · K-D 3.8L20: A (Ala) · Hydrophobic · K-D 1.8A2021: G (Gly) · Special · K-D -0.4G22: S (Ser) · Polar · K-D -0.8S23: L (Leu) · Hydrophobic · K-D 3.8L24: S (Ser) · Polar · K-D -0.8S25: M (Met) · Hydrophobic · K-D 1.9M2526: G (Gly) · Special · K-D -0.4G27: T (Thr) · Polar · K-D -0.7T28: G (Gly) · Special · K-D -0.4G29: I (Ile) · Hydrophobic · K-D 4.5I30: R (Arg) · Basic + · K-D -4.5R3031: K (Lys) · Basic + · K-D -3.9K32: A (Ala) · Hydrophobic · K-D 1.8A33: D (Asp) · Acidic − · K-D -3.5D34: A (Ala) · Hydrophobic · K-D 1.8A35: A (Ala) · Hydrophobic · K-D 1.8A3536: A (Ala) · Hydrophobic · K-D 1.8A37: G (Gly) · Special · K-D -0.4G38: N (Asn) · Polar · K-D -3.5N39: Q (Gln) · Polar · K-D -3.5Q40: N (Asn) · Polar · K-D -3.5N4041: Y (Tyr) · Aromatic · K-D -1.3Y42: A (Ala) · Hydrophobic · K-D 1.8A43: E (Glu) · Acidic − · K-D -3.5E44: A (Ala) · Hydrophobic · K-D 1.8A45: L (Leu) · Hydrophobic · K-D 3.8L4546: Q (Gln) · Polar · K-D -3.5Q47: K (Lys) · Basic + · K-D -3.9K48: A (Ala) · Hydrophobic · K-D 1.8A49: I (Ile) · Hydrophobic · K-D 4.5I50: Y (Tyr) · Aromatic · K-D -1.3Y5051: F (Phe) · Aromatic · K-D 2.8F52: Y (Tyr) · Aromatic · K-D -1.3Y53: E (Glu) · Acidic − · K-D -3.5E54: A (Ala) · Hydrophobic · K-D 1.8A55: Q (Gln) · Polar · K-D -3.5Q5556: R (Arg) · Basic + · K-D -4.5R57: S (Ser) · Polar · K-D -0.8S58: G (Gly) · Special · K-D -0.4G59: P (Pro) · Special · K-D -1.6P60: L (Leu) · Hydrophobic · K-D 3.8L6061: P (Pro) · Special · K-D -1.6P62: A (Ala) · Hydrophobic · K-D 1.8A63: S (Ser) · Polar · K-D -0.8S64: N (Asn) · Polar · K-D -3.5N65: R (Arg) · Basic + · K-D -4.5R6566: V (Val) · Hydrophobic · K-D 4.2V67: E (Glu) · Acidic − · K-D -3.5E68: W (Trp) · Aromatic · K-D -0.9W69: R (Arg) · Basic + · K-D -4.5R70: G (Gly) · Special · K-D -0.4G7071: N (Asn) · Polar · K-D -3.5N72: S (Ser) · Polar · K-D -0.8S73: G (Gly) · Special · K-D -0.4G74: I (Ile) · Hydrophobic · K-D 4.5I75: Q (Gln) · Polar · K-D -3.5Q7576: D (Asp) · Acidic − · K-D -3.5D77: G (Gly) · Special · K-D -0.4G78: A (Ala) · Hydrophobic · K-D 1.8A79: D (Asp) · Acidic − · K-D -3.5D80: V (Val) · Hydrophobic · K-D 4.2V8081: G (Gly) · Special · K-D -0.4G82: V (Val) · Hydrophobic · K-D 4.2V83: D (Asp) · Acidic − · K-D -3.5D84: L (Leu) · Hydrophobic · K-D 3.8L85: T (Thr) · Polar · K-D -0.7T8586: G (Gly) · Special · K-D -0.4G87: G (Gly) · Special · K-D -0.4G88: W (Trp) · Aromatic · K-D -0.9W89: Y (Tyr) · Aromatic · K-D -1.3Y90: D (Asp) · Acidic − · K-D -3.5D9091: A (Ala) · Hydrophobic · K-D 1.8A92: G (Gly) · Special · K-D -0.4G93: D (Asp) · Acidic − · K-D -3.5D94: H (His) · Basic + · K-D -3.2H95: V (Val) · Hydrophobic · K-D 4.2V9596: K (Lys) · Basic + · K-D -3.9K97: F (Phe) · Aromatic · K-D 2.8F98: G (Gly) · Special · K-D -0.4G99: F (Phe) · Aromatic · K-D 2.8F100: P (Pro) · Special · K-D -1.6P100101: M (Met) · Hydrophobic · K-D 1.9M102: A (Ala) · Hydrophobic · K-D 1.8A103: A (Ala) · Hydrophobic · K-D 1.8A104: S (Ser) · Polar · K-D -0.8S105: A (Ala) · Hydrophobic · K-D 1.8A105106: T (Thr) · Polar · K-D -0.7T107: M (Met) · Hydrophobic · K-D 1.9M108: L (Leu) · Hydrophobic · K-D 3.8L109: A (Ala) · Hydrophobic · K-D 1.8A110: W (Trp) · Aromatic · K-D -0.9W110111: S (Ser) · Polar · K-D -0.8S112: V (Val) · Hydrophobic · K-D 4.2V113: V (Val) · Hydrophobic · K-D 4.2V114: E (Glu) · Acidic − · K-D -3.5E115: Y (Tyr) · Aromatic · K-D -1.3Y115116: S (Ser) · Polar · K-D -0.8S117: D (Asp) · Acidic − · K-D -3.5D118: G (Gly) · Special · K-D -0.4G119: Y (Tyr) · Aromatic · K-D -1.3Y120: E (Glu) · Acidic − · K-D -3.5E120121: Q (Gln) · Polar · K-D -3.5Q122: A (Ala) · Hydrophobic · K-D 1.8A123: G (Gly) · Special · K-D -0.4G124: Q (Gln) · Polar · K-D -3.5Q125: L (Leu) · Hydrophobic · K-D 3.8L125126: E (Glu) · Acidic − · K-D -3.5E127: E (Glu) · Acidic − · K-D -3.5E128: I (Ile) · Hydrophobic · K-D 4.5I129: K (Lys) · Basic + · K-D -3.9K130: D (Asp) · Acidic − · K-D -3.5D130131: N (Asn) · Polar · K-D -3.5N132: I (Ile) · Hydrophobic · K-D 4.5I133: R (Arg) · Basic + · K-D -4.5R134: W (Trp) · Aromatic · K-D -0.9W135: A (Ala) · Hydrophobic · K-D 1.8A135136: T (Thr) · Polar · K-D -0.7T137: D (Asp) · Acidic − · K-D -3.5D138: Y (Tyr) · Aromatic · K-D -1.3Y139: F (Phe) · Aromatic · K-D 2.8F140: M (Met) · Hydrophobic · K-D 1.9M140141: K (Lys) · Basic + · K-D -3.9K142: A (Ala) · Hydrophobic · K-D 1.8A143: H (His) · Basic + · K-D -3.2H144: T (Thr) · Polar · K-D -0.7T145: K (Lys) · Basic + · K-D -3.9K145146: P (Pro) · Special · K-D -1.6P147: N (Asn) · Polar · K-D -3.5N148: E (Glu) · Acidic − · K-D -3.5E149: L (Leu) · Hydrophobic · K-D 3.8L150: W (Trp) · Aromatic · K-D -0.9W150151: G (Gly) · Special · K-D -0.4G152: Q (Gln) · Polar · K-D -3.5Q153: V (Val) · Hydrophobic · K-D 4.2V154: G (Gly) · Special · K-D -0.4G155: A (Ala) · Hydrophobic · K-D 1.8A155156: G (Gly) · Special · K-D -0.4G157: N (Asn) · Polar · K-D -3.5N158: T (Thr) · Polar · K-D -0.7T159: D (Asp) · Acidic − · K-D -3.5D160: H (His) · Basic + · K-D -3.2H160161: A (Ala) · Hydrophobic · K-D 1.8A162: W (Trp) · Aromatic · K-D -0.9W163: W (Trp) · Aromatic · K-D -0.9W164: G (Gly) · Special · K-D -0.4G165: P (Pro) · Special · K-D -1.6P165166: A (Ala) · Hydrophobic · K-D 1.8A167: E (Glu) · Acidic − · K-D -3.5E168: V (Val) · Hydrophobic · K-D 4.2V169: M (Met) · Hydrophobic · K-D 1.9M170: Q (Gln) · Polar · K-D -3.5Q170171: M (Met) · Hydrophobic · K-D 1.9M172: N (Asn) · Polar · K-D -3.5N173: R (Arg) · Basic + · K-D -4.5R174: P (Pro) · Special · K-D -1.6P175: S (Ser) · Polar · K-D -0.8S175176: F (Phe) · Aromatic · K-D 2.8F177: K (Lys) · Basic + · K-D -3.9K178: I (Ile) · Hydrophobic · K-D 4.5I179: D (Asp) · Acidic − · K-D -3.5D180: A (Ala) · Hydrophobic · K-D 1.8A180181: S (Ser) · Polar · K-D -0.8S182: C (Cys) · Special · K-D 2.5C183: P (Pro) · Special · K-D -1.6P184: G (Gly) · Special · K-D -0.4G185: S (Ser) · Polar · K-D -0.8S185186: D (Asp) · Acidic − · K-D -3.5D187: L (Leu) · Hydrophobic · K-D 3.8L188: A (Ala) · Hydrophobic · K-D 1.8A189: A (Ala) · Hydrophobic · K-D 1.8A190: E (Glu) · Acidic − · K-D -3.5E190191: T (Thr) · Polar · K-D -0.7T192: A (Ala) · Hydrophobic · K-D 1.8A193: A (Ala) · Hydrophobic · K-D 1.8A194: A (Ala) · Hydrophobic · K-D 1.8A195: L (Leu) · Hydrophobic · K-D 3.8L195196: A (Ala) · Hydrophobic · K-D 1.8A197: A (Ala) · Hydrophobic · K-D 1.8A198: S (Ser) · Polar · K-D -0.8S199: S (Ser) · Polar · K-D -0.8S200: I (Ile) · Hydrophobic · K-D 4.5I200201: V (Val) · Hydrophobic · K-D 4.2V202: F (Phe) · Aromatic · K-D 2.8F203: A (Ala) · Hydrophobic · K-D 1.8A204: D (Asp) · Acidic − · K-D -3.5D205: D (Asp) · Acidic − · K-D -3.5D205206: D (Asp) · Acidic − · K-D -3.5D207: P (Pro) · Special · K-D -1.6P208: A (Ala) · Hydrophobic · K-D 1.8A209: Y (Tyr) · Aromatic · K-D -1.3Y210: S (Ser) · Polar · K-D -0.8S210211: A (Ala) · Hydrophobic · K-D 1.8A212: R (Arg) · Basic + · K-D -4.5R213: L (Leu) · Hydrophobic · K-D 3.8L214: L (Leu) · Hydrophobic · K-D 3.8L215: Q (Gln) · Polar · K-D -3.5Q215216: H (His) · Basic + · K-D -3.2H217: A (Ala) · Hydrophobic · K-D 1.8A218: K (Lys) · Basic + · K-D -3.9K219: E (Glu) · Acidic − · K-D -3.5E220: L (Leu) · Hydrophobic · K-D 3.8L220221: Y (Tyr) · Aromatic · K-D -1.3Y222: N (Asn) · Polar · K-D -3.5N223: F (Phe) · Aromatic · K-D 2.8F224: A (Ala) · Hydrophobic · K-D 1.8A225: Y (Tyr) · Aromatic · K-D -1.3Y225226: T (Thr) · Polar · K-D -0.7T227: Y (Tyr) · Aromatic · K-D -1.3Y228: R (Arg) · Basic + · K-D -4.5R229: G (Gly) · Special · K-D -0.4G230: E (Glu) · Acidic − · K-D -3.5E230231: Y (Tyr) · Aromatic · K-D -1.3Y232: T (Thr) · Polar · K-D -0.7T233: D (Asp) · Acidic − · K-D -3.5D234: C (Cys) · Special · K-D 2.5C235: I (Ile) · Hydrophobic · K-D 4.5I235236: T (Thr) · Polar · K-D -0.7T237: D (Asp) · Acidic − · K-D -3.5D238: A (Ala) · Hydrophobic · K-D 1.8A239: A (Ala) · Hydrophobic · K-D 1.8A240: A (Ala) · Hydrophobic · K-D 1.8A240241: F (Phe) · Aromatic · K-D 2.8F242: Y (Tyr) · Aromatic · K-D -1.3Y243: N (Asn) · Polar · K-D -3.5N244: S (Ser) · Polar · K-D -0.8S245: W (Trp) · Aromatic · K-D -0.9W245246: T (Thr) · Polar · K-D -0.7T247: G (Gly) · Special · K-D -0.4G248: Y (Tyr) · Aromatic · K-D -1.3Y249: E (Glu) · Acidic − · K-D -3.5E250: D (Asp) · Acidic − · K-D -3.5D250251: E (Glu) · Acidic − · K-D -3.5E252: L (Leu) · Hydrophobic · K-D 3.8L253: A (Ala) · Hydrophobic · K-D 1.8A254: W (Trp) · Aromatic · K-D -0.9W255: G (Gly) · Special · K-D -0.4G255256: G (Gly) · Special · K-D -0.4G257: A (Ala) · Hydrophobic · K-D 1.8A258: W (Trp) · Aromatic · K-D -0.9W259: L (Leu) · Hydrophobic · K-D 3.8L260: Y (Tyr) · Aromatic · K-D -1.3Y260261: L (Leu) · Hydrophobic · K-D 3.8L262: A (Ala) · Hydrophobic · K-D 1.8A263: T (Thr) · Polar · K-D -0.7T264: N (Asn) · Polar · K-D -3.5N265: D (Asp) · Acidic − · K-D -3.5D265266: S (Ser) · Polar · K-D -0.8S267: A (Ala) · Hydrophobic · K-D 1.8A268: Y (Tyr) · Aromatic · K-D -1.3Y269: L (Leu) · Hydrophobic · K-D 3.8L270: S (Ser) · Polar · K-D -0.8S270271: K (Lys) · Basic + · K-D -3.9K272: A (Ala) · Hydrophobic · K-D 1.8A273: I (Ile) · Hydrophobic · K-D 4.5I274: A (Ala) · Hydrophobic · K-D 1.8A275: A (Ala) · Hydrophobic · K-D 1.8A275276: T (Thr) · Polar · K-D -0.7T277: D (Asp) · Acidic − · K-D -3.5D278: R (Arg) · Basic + · K-D -4.5R279: W (Trp) · Aromatic · K-D -0.9W280: S (Ser) · Polar · K-D -0.8S280281: S (Ser) · Polar · K-D -0.8S282: S (Ser) · Polar · K-D -0.8S283: G (Gly) · Special · K-D -0.4G284: G (Gly) · Special · K-D -0.4G285: S (Ser) · Polar · K-D -0.8S285286: A (Ala) · Hydrophobic · K-D 1.8A287: N (Asn) · Polar · K-D -3.5N288: W (Trp) · Aromatic · K-D -0.9W289: P (Pro) · Special · K-D -1.6P290: Y (Tyr) · Aromatic · K-D -1.3Y290291: T (Thr) · Polar · K-D -0.7T292: W (Trp) · Aromatic · K-D -0.9W293: T (Thr) · Polar · K-D -0.7T294: Q (Gln) · Polar · K-D -3.5Q295: G (Gly) · Special · K-D -0.4G295296: W (Trp) · Aromatic · K-D -0.9W297: D (Asp) · Acidic − · K-D -3.5D298: S (Ser) · Polar · K-D -0.8S299: K (Lys) · Basic + · K-D -3.9K300: H (His) · Basic + · K-D -3.2H300301: Y (Tyr) · Aromatic · K-D -1.3Y302: G (Gly) · Special · K-D -0.4G303: A (Ala) · Hydrophobic · K-D 1.8A304: Q (Gln) · Polar · K-D -3.5Q305: I (Ile) · Hydrophobic · K-D 4.5I305306: L (Leu) · Hydrophobic · K-D 3.8L307: L (Leu) · Hydrophobic · K-D 3.8L308: A (Ala) · Hydrophobic · K-D 1.8A309: R (Arg) · Basic + · K-D -4.5R310: I (Ile) · Hydrophobic · K-D 4.5I310311: T (Thr) · Polar · K-D -0.7T312: S (Ser) · Polar · K-D -0.8S313: S (Ser) · Polar · K-D -0.8S314: L (Leu) · Hydrophobic · K-D 3.8L315: N (Asn) · Polar · K-D -3.5N315316: M (Met) · Hydrophobic · K-D 1.9M317: P (Pro) · Special · K-D -1.6P318: E (Glu) · Acidic − · K-D -3.5E319: A (Ala) · Hydrophobic · K-D 1.8A320: T (Thr) · Polar · K-D -0.7T320321: R (Arg) · Basic + · K-D -4.5R322: F (Phe) · Aromatic · K-D 2.8F323: I (Ile) · Hydrophobic · K-D 4.5I324: Q (Gln) · Polar · K-D -3.5Q325: S (Ser) · Polar · K-D -0.8S325326: T (Thr) · Polar · K-D -0.7T327: E (Glu) · Acidic − · K-D -3.5E328: R (Arg) · Basic + · K-D -4.5R329: N (Asn) · Polar · K-D -3.5N330: L (Leu) · Hydrophobic · K-D 3.8L330331: D (Asp) · Acidic − · K-D -3.5D332: Y (Tyr) · Aromatic · K-D -1.3Y333: W (Trp) · Aromatic · K-D -0.9W334: T (Thr) · Polar · K-D -0.7T335: V (Val) · Hydrophobic · K-D 4.2V335336: G (Gly) · Special · K-D -0.4G337: V (Val) · Hydrophobic · K-D 4.2V338: N (Asn) · Polar · K-D -3.5N339: G (Gly) · Special · K-D -0.4G340: T (Thr) · Polar · K-D -0.7T340341: R (Arg) · Basic + · K-D -4.5R342: V (Val) · Hydrophobic · K-D 4.2V343: K (Lys) · Basic + · K-D -3.9K344: Y (Tyr) · Aromatic · K-D -1.3Y345: T (Thr) · Polar · K-D -0.7T345346: P (Pro) · Special · K-D -1.6P347: G (Gly) · Special · K-D -0.4G348: G (Gly) · Special · K-D -0.4G349: L (Leu) · Hydrophobic · K-D 3.8L350: A (Ala) · Hydrophobic · K-D 1.8A350351: W (Trp) · Aromatic · K-D -0.9W352: L (Leu) · Hydrophobic · K-D 3.8L353: D (Asp) · Acidic − · K-D -3.5D354: Q (Gln) · Polar · K-D -3.5Q355: W (Trp) · Aromatic · K-D -0.9W355356: G (Gly) · Special · K-D -0.4G357: S (Ser) · Polar · K-D -0.8S358: L (Leu) · Hydrophobic · K-D 3.8L359: R (Arg) · Basic + · K-D -4.5R360: Y (Tyr) · Aromatic · K-D -1.3Y360361: A (Ala) · Hydrophobic · K-D 1.8A362: A (Ala) · Hydrophobic · K-D 1.8A363: N (Asn) · Polar · K-D -3.5N364: A (Ala) · Hydrophobic · K-D 1.8A365: S (Ser) · Polar · K-D -0.8S365366: F (Phe) · Aromatic · K-D 2.8F367: I (Ile) · Hydrophobic · K-D 4.5I368: S (Ser) · Polar · K-D -0.8S369: F (Phe) · Aromatic · K-D 2.8F370: V (Val) · Hydrophobic · K-D 4.2V370371: Y (Tyr) · Aromatic · K-D -1.3Y372: S (Ser) · Polar · K-D -0.8S373: D (Asp) · Acidic − · K-D -3.5D374: W (Trp) · Aromatic · K-D -0.9W375: V (Val) · Hydrophobic · K-D 4.2V375376: S (Ser) · Polar · K-D -0.8S377: D (Asp) · Acidic − · K-D -3.5D378: P (Pro) · Special · K-D -1.6P379: V (Val) · Hydrophobic · K-D 4.2V380: K (Lys) · Basic + · K-D -3.9K380381: K (Lys) · Basic + · K-D -3.9K382: S (Ser) · Polar · K-D -0.8S383: R (Arg) · Basic + · K-D -4.5R384: Y (Tyr) · Aromatic · K-D -1.3Y385: Q (Gln) · Polar · K-D -3.5Q385386: D (Asp) · Acidic − · K-D -3.5D387: F (Phe) · Aromatic · K-D 2.8F388: A (Ala) · Hydrophobic · K-D 1.8A389: V (Val) · Hydrophobic · K-D 4.2V390: S (Ser) · Polar · K-D -0.8S390391: Q (Gln) · Polar · K-D -3.5Q392: M (Met) · Hydrophobic · K-D 1.9M393: N (Asn) · Polar · K-D -3.5N394: Y (Tyr) · Aromatic · K-D -1.3Y395: I (Ile) · Hydrophobic · K-D 4.5I395396: L (Leu) · Hydrophobic · K-D 3.8L397: G (Gly) · Special · K-D -0.4G398: D (Asp) · Acidic − · K-D -3.5D399: N (Asn) · Polar · K-D -3.5N400: P (Pro) · Special · K-D -1.6P400401: R (Arg) · Basic + · K-D -4.5R402: Q (Gln) · Polar · K-D -3.5Q403: S (Ser) · Polar · K-D -0.8S404: S (Ser) · Polar · K-D -0.8S405: Y (Tyr) · Aromatic · K-D -1.3Y405406: V (Val) · Hydrophobic · K-D 4.2V407: V (Val) · Hydrophobic · K-D 4.2V408: G (Gly) · Special · K-D -0.4G409: Y (Tyr) · Aromatic · K-D -1.3Y410: G (Gly) · Special · K-D -0.4G410411: Q (Gln) · Polar · K-D -3.5Q412: N (Asn) · Polar · K-D -3.5N413: A (Ala) · Hydrophobic · K-D 1.8A414: P (Pro) · Special · K-D -1.6P415: Q (Gln) · Polar · K-D -3.5Q415416: H (His) · Basic + · K-D -3.2H417: P (Pro) · Special · K-D -1.6P418: H (His) · Basic + · K-D -3.2H419: H (His) · Basic + · K-D -3.2H420: R (Arg) · Basic + · K-D -4.5R420421: T (Thr) · Polar · K-D -0.7T422: A (Ala) · Hydrophobic · K-D 1.8A423: H (His) · Basic + · K-D -3.2H424: G (Gly) · Special · K-D -0.4G425: S (Ser) · Polar · K-D -0.8S425426: W (Trp) · Aromatic · K-D -0.9W427: L (Leu) · Hydrophobic · K-D 3.8L428: N (Asn) · Polar · K-D -3.5N429: N (Asn) · Polar · K-D -3.5N430: E (Glu) · Acidic − · K-D -3.5E430431: D (Asp) · Acidic − · K-D -3.5D432: I (Ile) · Hydrophobic · K-D 4.5I433: P (Pro) · Special · K-D -1.6P434: A (Ala) · Hydrophobic · K-D 1.8A435: N (Asn) · Polar · K-D -3.5N435436: H (His) · Basic + · K-D -3.2H437: R (Arg) · Basic + · K-D -4.5R438: H (His) · Basic + · K-D -3.2H439: I (Ile) · Hydrophobic · K-D 4.5I440: L (Leu) · Hydrophobic · K-D 3.8L440441: Y (Tyr) · Aromatic · K-D -1.3Y442: G (Gly) · Special · K-D -0.4G443: A (Ala) · Hydrophobic · K-D 1.8A444: M (Met) · Hydrophobic · K-D 1.9M445: V (Val) · Hydrophobic · K-D 4.2V445446: G (Gly) · Special · K-D -0.4G447: G (Gly) · Special · K-D -0.4G448: P (Pro) · Special · K-D -1.6P449: D (Asp) · Acidic − · K-D -3.5D450: A (Ala) · Hydrophobic · K-D 1.8A450451: S (Ser) · Polar · K-D -0.8S452: D (Asp) · Acidic − · K-D -3.5D453: G (Gly) · Special · K-D -0.4G454: Y (Tyr) · Aromatic · K-D -1.3Y455: T (Thr) · Polar · K-D -0.7T455456: D (Asp) · Acidic − · K-D -3.5D457: D (Asp) · Acidic − · K-D -3.5D458: I (Ile) · Hydrophobic · K-D 4.5I459: G (Gly) · Special · K-D -0.4G460: D (Asp) · Acidic − · K-D -3.5D460461: Y (Tyr) · Aromatic · K-D -1.3Y462: V (Val) · Hydrophobic · K-D 4.2V463: S (Ser) · Polar · K-D -0.8S464: N (Asn) · Polar · K-D -3.5N465: E (Glu) · Acidic − · K-D -3.5E465466: V (Val) · Hydrophobic · K-D 4.2V467: A (Ala) · Hydrophobic · K-D 1.8A468: T (Thr) · Polar · K-D -0.7T469: D (Asp) · Acidic − · K-D -3.5D470: Y (Tyr) · Aromatic · K-D -1.3Y470471: N (Asn) · Polar · K-D -3.5N472: A (Ala) · Hydrophobic · K-D 1.8A473: G (Gly) · Special · K-D -0.4G474: F (Phe) · Aromatic · K-D 2.8F475: T (Thr) · Polar · K-D -0.7T475476: G (Gly) · Special · K-D -0.4G477: A (Ala) · Hydrophobic · K-D 1.8A478: L (Leu) · Hydrophobic · K-D 3.8L479: A (Ala) · Hydrophobic · K-D 1.8A480: K (Lys) · Basic + · K-D -3.9K480481: M (Met) · Hydrophobic · K-D 1.9M482: N (Asn) · Polar · K-D -3.5N483: L (Leu) · Hydrophobic · K-D 3.8L484: L (Leu) · Hydrophobic · K-D 3.8L485: F (Phe) · Aromatic · K-D 2.8F485486: G (Gly) · Special · K-D -0.4G487: Q (Gln) · Polar · K-D -3.5Q488: N (Asn) · Polar · K-D -3.5N489: H (His) · Basic + · K-D -3.2H490: Q (Gln) · Polar · K-D -3.5Q490491: P (Pro) · Special · K-D -1.6P492: L (Leu) · Hydrophobic · K-D 3.8L493: A (Ala) · Hydrophobic · K-D 1.8A494: N (Asn) · Polar · K-D -3.5N495: F (Phe) · Aromatic · K-D 2.8F495496: P (Pro) · Special · K-D -1.6P497: A (Ala) · Hydrophobic · K-D 1.8A498: P (Pro) · Special · K-D -1.6P499: E (Glu) · Acidic − · K-D -3.5E500: V (Val) · Hydrophobic · K-D 4.2V500501: K (Lys) · Basic + · K-D -3.9K502: G (Gly) · Special · K-D -0.4G503: D (Asp) · Acidic − · K-D -3.5D504: E (Glu) · Acidic − · K-D -3.5E505: F (Phe) · Aromatic · K-D 2.8F505506: F (Phe) · Aromatic · K-D 2.8F507: V (Val) · Hydrophobic · K-D 4.2V508: E (Glu) · Acidic − · K-D -3.5E509: A (Ala) · Hydrophobic · K-D 1.8A510: A (Ala) · Hydrophobic · K-D 1.8A510511: I (Ile) · Hydrophobic · K-D 4.5I512: K (Lys) · Basic + · K-D -3.9K513: S (Ser) · Polar · K-D -0.8S514: S (Ser) · Polar · K-D -0.8S515: G (Gly) · Special · K-D -0.4G515516: A (Ala) · Hydrophobic · K-D 1.8A517: N (Asn) · Polar · K-D -3.5N518: Y (Tyr) · Aromatic · K-D -1.3Y519: T (Thr) · Polar · K-D -0.7T520: E (Glu) · Acidic − · K-D -3.5E520521: I (Ile) · Hydrophobic · K-D 4.5I522: R (Arg) · Basic + · K-D -4.5R523: A (Ala) · Hydrophobic · K-D 1.8A524: Q (Gln) · Polar · K-D -3.5Q525: L (Leu) · Hydrophobic · K-D 3.8L525526: N (Asn) · Polar · K-D -3.5N527: N (Asn) · Polar · K-D -3.5N528: R (Arg) · Basic + · K-D -4.5R529: S (Ser) · Polar · K-D -0.8S530: A (Ala) · Hydrophobic · K-D 1.8A530531: W (Trp) · Aromatic · K-D -0.9W532: P (Pro) · Special · K-D -1.6P533: A (Ala) · Hydrophobic · K-D 1.8A534: R (Arg) · Basic + · K-D -4.5R535: M (Met) · Hydrophobic · K-D 1.9M535536: G (Gly) · Special · K-D -0.4G537: D (Asp) · Acidic − · K-D -3.5D538: Q (Gln) · Polar · K-D -3.5Q539: L (Leu) · Hydrophobic · K-D 3.8L540: S (Ser) · Polar · K-D -0.8S540541: F (Phe) · Aromatic · K-D 2.8F542: K (Lys) · Basic + · K-D -3.9K543: Y (Tyr) · Aromatic · K-D -1.3Y544: F (Phe) · Aromatic · K-D 2.8F545: L (Leu) · Hydrophobic · K-D 3.8L545546: D (Asp) · Acidic − · K-D -3.5D547: L (Leu) · Hydrophobic · K-D 3.8L548: S (Ser) · Polar · K-D -0.8S549: E (Glu) · Acidic − · K-D -3.5E550: V (Val) · Hydrophobic · K-D 4.2V550551: Y (Tyr) · Aromatic · K-D -1.3Y552: A (Ala) · Hydrophobic · K-D 1.8A553: A (Ala) · Hydrophobic · K-D 1.8A554: G (Gly) · Special · K-D -0.4G555: R (Arg) · Basic + · K-D -4.5R555556: T (Thr) · Polar · K-D -0.7T557: V (Val) · Hydrophobic · K-D 4.2V558: S (Ser) · Polar · K-D -0.8S559: D (Asp) · Acidic − · K-D -3.5D560: V (Val) · Hydrophobic · K-D 4.2V560561: Q (Gln) · Polar · K-D -3.5Q562: V (Val) · Hydrophobic · K-D 4.2V563: T (Thr) · Polar · K-D -0.7T564: T (Thr) · Polar · K-D -0.7T565: S (Ser) · Polar · K-D -0.8S565566: Y (Tyr) · Aromatic · K-D -1.3Y567: T (Thr) · Polar · K-D -0.7T568: E (Glu) · Acidic − · K-D -3.5E569: G (Gly) · Special · K-D -0.4G570: A (Ala) · Hydrophobic · K-D 1.8A570571: T (Thr) · Polar · K-D -0.7T572: V (Val) · Hydrophobic · K-D 4.2V573: S (Ser) · Polar · K-D -0.8S574: Q (Gln) · Polar · K-D -3.5Q575: P (Pro) · Special · K-D -1.6P575576: V (Val) · Hydrophobic · K-D 4.2V577: V (Val) · Hydrophobic · K-D 4.2V578: V (Val) · Hydrophobic · K-D 4.2V579: N (Asn) · Polar · K-D -3.5N580: A (Ala) · Hydrophobic · K-D 1.8A580581: A (Ala) · Hydrophobic · K-D 1.8A582: Q (Gln) · Polar · K-D -3.5Q583: H (His) · Basic + · K-D -3.2H584: I (Ile) · Hydrophobic · K-D 4.5I585: Y (Tyr) · Aromatic · K-D -1.3Y585586: A (Ala) · Hydrophobic · K-D 1.8A587: I (Ile) · Hydrophobic · K-D 4.5I588: T (Thr) · Polar · K-D -0.7T589: A (Ala) · Hydrophobic · K-D 1.8A590: N (Asn) · Polar · K-D -3.5N590591: F (Phe) · Aromatic · K-D 2.8F592: G (Gly) · Special · K-D -0.4G593: N (Asn) · Polar · K-D -3.5N594: T (Thr) · Polar · K-D -0.7T595: K (Lys) · Basic + · K-D -3.9K595596: I (Ile) · Hydrophobic · K-D 4.5I597: Y (Tyr) · Aromatic · K-D -1.3Y598: P (Pro) · Special · K-D -1.6P599: G (Gly) · Special · K-D -0.4G600: G (Gly) · Special · K-D -0.4G600601: E (Glu) · Acidic − · K-D -3.5E602: G (Gly) · Special · K-D -0.4G603: N (Asn) · Polar · K-D -3.5N604: Y (Tyr) · Aromatic · K-D -1.3Y605: R (Arg) · Basic + · K-D -4.5R605606: K (Lys) · Basic + · K-D -3.9K607: E (Glu) · Acidic − · K-D -3.5E608: V (Val) · Hydrophobic · K-D 4.2V609: Q (Gln) · Polar · K-D -3.5Q610: F (Phe) · Aromatic · K-D 2.8F610611: R (Arg) · Basic + · K-D -4.5R612: I (Ile) · Hydrophobic · K-D 4.5I613: T (Thr) · Polar · K-D -0.7T614: G (Gly) · Special · K-D -0.4G615: P (Pro) · Special · K-D -1.6P615616: Q (Gln) · Polar · K-D -3.5Q617: G (Gly) · Special · K-D -0.4G618: A (Ala) · Hydrophobic · K-D 1.8A619: W (Trp) · Aromatic · K-D -0.9W620: N (Asn) · Polar · K-D -3.5N620621: A (Ala) · Hydrophobic · K-D 1.8A622: S (Ser) · Polar · K-D -0.8S623: N (Asn) · Polar · K-D -3.5N624: D (Asp) · Acidic − · K-D -3.5D625: H (His) · Basic + · K-D -3.2H625626: S (Ser) · Polar · K-D -0.8S627: F (Phe) · Aromatic · K-D 2.8F628: Q (Gln) · Polar · K-D -3.5Q629: T (Thr) · Polar · K-D -0.7T630: L (Leu) · Hydrophobic · K-D 3.8L630631: T (Thr) · Polar · K-D -0.7T632: T (Thr) · Polar · K-D -0.7T633: G (Gly) · Special · K-D -0.4G634: T (Thr) · Polar · K-D -0.7T635: P (Pro) · Special · K-D -1.6P635636: V (Val) · Hydrophobic · K-D 4.2V637: K (Lys) · Basic + · K-D -3.9K638: S (Ser) · Polar · K-D -0.8S639: I (Ile) · Hydrophobic · K-D 4.5I640: Y (Tyr) · Aromatic · K-D -1.3Y640641: L (Leu) · Hydrophobic · K-D 3.8L642: P (Pro) · Special · K-D -1.6P643: V (Val) · Hydrophobic · K-D 4.2V644: Y (Tyr) · Aromatic · K-D -1.3Y645: D (Asp) · Acidic − · K-D -3.5D645646: A (Ala) · Hydrophobic · K-D 1.8A647: G (Gly) · Special · K-D -0.4G648: V (Val) · Hydrophobic · K-D 4.2V649: K (Lys) · Basic + · K-D -3.9K650: V (Val) · Hydrophobic · K-D 4.2V650651: Y (Tyr) · Aromatic · K-D -1.3Y652: G (Gly) · Special · K-D -0.4G653: Q (Gln) · Polar · K-D -3.5Q654: E (Glu) · Acidic − · K-D -3.5E655: P (Pro) · Special · K-D -1.6P655656: G (Gly) · Special · K-D -0.4G657: L (Leu) · Hydrophobic · K-D 3.8L658: T (Thr) · Polar · K-D -0.7T659: P (Pro) · Special · K-D -1.6P660: V (Val) · Hydrophobic · K-D 4.2V660661: T (Thr) · Polar · K-D -0.7T662: V (Val) · Hydrophobic · K-D 4.2V663: P (Pro) · Special · K-D -1.6P664: G (Gly) · Special · K-D -0.4G665: A (Ala) · Hydrophobic · K-D 1.8A665666: P (Pro) · Special · K-D -1.6P667: A (Ala) · Hydrophobic · K-D 1.8A668: G (Gly) · Special · K-D -0.4G669: V (Val) · Hydrophobic · K-D 4.2V670: Q (Gln) · Polar · K-D -3.5Q670671: A (Ala) · Hydrophobic · K-D 1.8A672: V (Val) · Hydrophobic · K-D 4.2V673: A (Ala) · Hydrophobic · K-D 1.8A674: G (Gly) · Special · K-D -0.4G675: S (Ser) · Polar · K-D -0.8S675676: S (Ser) · Polar · K-D -0.8S677: Q (Gln) · Polar · K-D -3.5Q678: V (Val) · Hydrophobic · K-D 4.2V679: N (Asn) · Polar · K-D -3.5N680: L (Leu) · Hydrophobic · K-D 3.8L680681: T (Thr) · Polar · K-D -0.7T682: W (Trp) · Aromatic · K-D -0.9W683: A (Ala) · Hydrophobic · K-D 1.8A684: A (Ala) · Hydrophobic · K-D 1.8A685: V (Val) · Hydrophobic · K-D 4.2V685686: S (Ser) · Polar · K-D -0.8S687: G (Gly) · Special · K-D -0.4G688: A (Ala) · Hydrophobic · K-D 1.8A689: E (Glu) · Acidic − · K-D -3.5E690: S (Ser) · Polar · K-D -0.8S690691: Y (Tyr) · Aromatic · K-D -1.3Y692: T (Thr) · Polar · K-D -0.7T693: V (Val) · Hydrophobic · K-D 4.2V694: K (Lys) · Basic + · K-D -3.9K695: R (Arg) · Basic + · K-D -4.5R695696: S (Ser) · Polar · K-D -0.8S697: E (Glu) · Acidic − · K-D -3.5E698: V (Val) · Hydrophobic · K-D 4.2V699: S (Ser) · Polar · K-D -0.8S700: G (Gly) · Special · K-D -0.4G700701: G (Gly) · Special · K-D -0.4G702: P (Pro) · Special · K-D -1.6P703: Y (Tyr) · Aromatic · K-D -1.3Y704: T (Thr) · Polar · K-D -0.7T705: T (Thr) · Polar · K-D -0.7T705706: V (Val) · Hydrophobic · K-D 4.2V707: A (Ala) · Hydrophobic · K-D 1.8A708: T (Thr) · Polar · K-D -0.7T709: G (Gly) · Special · K-D -0.4G710: V (Val) · Hydrophobic · K-D 4.2V710711: N (Asn) · Polar · K-D -3.5N712: G (Gly) · Special · K-D -0.4G713: L (Leu) · Hydrophobic · K-D 3.8L714: T (Thr) · Polar · K-D -0.7T715: Y (Tyr) · Aromatic · K-D -1.3Y715716: T (Thr) · Polar · K-D -0.7T717: N (Asn) · Polar · K-D -3.5N718: T (Thr) · Polar · K-D -0.7T719: G (Gly) · Special · K-D -0.4G720: L (Leu) · Hydrophobic · K-D 3.8L720721: T (Thr) · Polar · K-D -0.7T722: N (Asn) · Polar · K-D -3.5N723: G (Gly) · Special · K-D -0.4G724: T (Thr) · Polar · K-D -0.7T725: T (Thr) · Polar · K-D -0.7T725726: Y (Tyr) · Aromatic · K-D -1.3Y727: Y (Tyr) · Aromatic · K-D -1.3Y728: Y (Tyr) · Aromatic · K-D -1.3Y729: V (Val) · Hydrophobic · K-D 4.2V730: V (Val) · Hydrophobic · K-D 4.2V730731: T (Thr) · Polar · K-D -0.7T732: A (Ala) · Hydrophobic · K-D 1.8A733: V (Val) · Hydrophobic · K-D 4.2V734: N (Asn) · Polar · K-D -3.5N735: S (Ser) · Polar · K-D -0.8S735736: A (Ala) · Hydrophobic · K-D 1.8A737: G (Gly) · Special · K-D -0.4G738: E (Glu) · Acidic − · K-D -3.5E739: S (Ser) · Polar · K-D -0.8S740: S (Ser) · Polar · K-D -0.8S740741: G (Gly) · Special · K-D -0.4G742: S (Ser) · Polar · K-D -0.8S743: V (Val) · Hydrophobic · K-D 4.2V744: Q (Gln) · Polar · K-D -3.5Q745: V (Val) · Hydrophobic · K-D 4.2V745746: S (Ser) · Polar · K-D -0.8S747: A (Ala) · Hydrophobic · K-D 1.8A748: T (Thr) · Polar · K-D -0.7T749: P (Pro) · Special · K-D -1.6P750: Q (Gln) · Polar · K-D -3.5Q750751: A (Ala) · Hydrophobic · K-D 1.8A752: A (Ala) · Hydrophobic · K-D 1.8A753: S (Ser) · Polar · K-D -0.8S754: T (Thr) · Polar · K-D -0.7T755: V (Val) · Hydrophobic · K-D 4.2V755756: P (Pro) · Special · K-D -1.6P757: G (Gly) · Special · K-D -0.4G758: A (Ala) · Hydrophobic · K-D 1.8A759: L (Leu) · Hydrophobic · K-D 3.8L760: T (Thr) · Polar · K-D -0.7T760761: L (Leu) · Hydrophobic · K-D 3.8L762: S (Ser) · Polar · K-D -0.8S763: G (Gly) · Special · K-D -0.4G764: T (Thr) · Polar · K-D -0.7T765: A (Ala) · Hydrophobic · K-D 1.8A765766: G (Gly) · Special · K-D -0.4G767: N (Asn) · Polar · K-D -3.5N768: A (Ala) · Hydrophobic · K-D 1.8A769: Q (Gln) · Polar · K-D -3.5Q770: S (Ser) · Polar · K-D -0.8S770771: V (Val) · Hydrophobic · K-D 4.2V772: L (Leu) · Hydrophobic · K-D 3.8L773: T (Thr) · Polar · K-D -0.7T774: W (Trp) · Aromatic · K-D -0.9W775: T (Thr) · Polar · K-D -0.7T775776: T (Thr) · Polar · K-D -0.7T777: A (Ala) · Hydrophobic · K-D 1.8A778: S (Ser) · Polar · K-D -0.8S779: G (Gly) · Special · K-D -0.4G780: A (Ala) · Hydrophobic · K-D 1.8A780781: T (Thr) · Polar · K-D -0.7T782: T (Thr) · Polar · K-D -0.7T783: Y (Tyr) · Aromatic · K-D -1.3Y784: K (Lys) · Basic + · K-D -3.9K785: V (Val) · Hydrophobic · K-D 4.2V785786: Q (Gln) · Polar · K-D -3.5Q787: R (Arg) · Basic + · K-D -4.5R788: S (Ser) · Polar · K-D -0.8S789: V (Val) · Hydrophobic · K-D 4.2V790: A (Ala) · Hydrophobic · K-D 1.8A790791: G (Gly) · Special · K-D -0.4G792: G (Gly) · Special · K-D -0.4G793: T (Thr) · Polar · K-D -0.7T794: Y (Tyr) · Aromatic · K-D -1.3Y795: A (Ala) · Hydrophobic · K-D 1.8A795796: D (Asp) · Acidic − · K-D -3.5D797: V (Val) · Hydrophobic · K-D 4.2V798: A (Ala) · Hydrophobic · K-D 1.8A799: T (Thr) · Polar · K-D -0.7T800: G (Gly) · Special · K-D -0.4G800801: L (Leu) · Hydrophobic · K-D 3.8L802: S (Ser) · Polar · K-D -0.8S803: V (Val) · Hydrophobic · K-D 4.2V804: L (Leu) · Hydrophobic · K-D 3.8L805: T (Thr) · Polar · K-D -0.7T805806: Y (Tyr) · Aromatic · K-D -1.3Y807: T (Thr) · Polar · K-D -0.7T808: D (Asp) · Acidic − · K-D -3.5D809: T (Thr) · Polar · K-D -0.7T810: T (Thr) · Polar · K-D -0.7T810811: A (Ala) · Hydrophobic · K-D 1.8A812: L (Leu) · Hydrophobic · K-D 3.8L813: N (Asn) · Polar · K-D -3.5N814: G (Gly) · Special · K-D -0.4G815: T (Thr) · Polar · K-D -0.7T815816: T (Thr) · Polar · K-D -0.7T817: Y (Tyr) · Aromatic · K-D -1.3Y818: N (Asn) · Polar · K-D -3.5N819: Y (Tyr) · Aromatic · K-D -1.3Y820: R (Arg) · Basic + · K-D -4.5R820821: I (Ile) · Hydrophobic · K-D 4.5I822: A (Ala) · Hydrophobic · K-D 1.8A823: A (Ala) · Hydrophobic · K-D 1.8A824: V (Val) · Hydrophobic · K-D 4.2V825: N (Asn) · Polar · K-D -3.5N825826: A (Ala) · Hydrophobic · K-D 1.8A827: N (Asn) · Polar · K-D -3.5N828: G (Gly) · Special · K-D -0.4G829: Q (Gln) · Polar · K-D -3.5Q830: T (Thr) · Polar · K-D -0.7T830831: L (Leu) · Hydrophobic · K-D 3.8L832: S (Ser) · Polar · K-D -0.8S833: N (Asn) · Polar · K-D -3.5N834: V (Val) · Hydrophobic · K-D 4.2V835: L (Leu) · Hydrophobic · K-D 3.8L835836: A (Ala) · Hydrophobic · K-D 1.8A837: L (Leu) · Hydrophobic · K-D 3.8L838: T (Thr) · Polar · K-D -0.7T839: P (Pro) · Special · K-D -1.6P840: S (Ser) · Polar · K-D -0.8S840841: A (Ala) · Hydrophobic · K-D 1.8A842: P (Pro) · Special · K-D -1.6P843: P (Pro) · Special · K-D -1.6P844: V (Val) · Hydrophobic · K-D 4.2V845: T (Thr) · Polar · K-D -0.7T845846: T (Thr) · Polar · K-D -0.7T847: G (Gly) · Special · K-D -0.4G848: T (Thr) · Polar · K-D -0.7T849: L (Leu) · Hydrophobic · K-D 3.8L850: E (Glu) · Acidic − · K-D -3.5E850851: V (Val) · Hydrophobic · K-D 4.2V852: Q (Gln) · Polar · K-D -3.5Q853: Y (Tyr) · Aromatic · K-D -1.3Y854: R (Arg) · Basic + · K-D -4.5R855: S (Ser) · Polar · K-D -0.8S855856: G (Gly) · Special · K-D -0.4G857: G (Gly) · Special · K-D -0.4G858: S (Ser) · Polar · K-D -0.8S859: G (Gly) · Special · K-D -0.4G860: N (Asn) · Polar · K-D -3.5N860861: S (Ser) · Polar · K-D -0.8S862: S (Ser) · Polar · K-D -0.8S863: N (Asn) · Polar · K-D -3.5N864: A (Ala) · Hydrophobic · K-D 1.8A865: A (Ala) · Hydrophobic · K-D 1.8A865866: T (Thr) · Polar · K-D -0.7T867: P (Pro) · Special · K-D -1.6P868: Q (Gln) · Polar · K-D -3.5Q869: F (Phe) · Aromatic · K-D 2.8F870: N (Asn) · Polar · K-D -3.5N870871: V (Val) · Hydrophobic · K-D 4.2V872: K (Lys) · Basic + · K-D -3.9K873: N (Asn) · Polar · K-D -3.5N874: T (Thr) · Polar · K-D -0.7T875: G (Gly) · Special · K-D -0.4G875876: T (Thr) · Polar · K-D -0.7T877: Q (Gln) · Polar · K-D -3.5Q878: A (Ala) · Hydrophobic · K-D 1.8A879: I (Ile) · Hydrophobic · K-D 4.5I880: D (Asp) · Acidic − · K-D -3.5D880881: L (Leu) · Hydrophobic · K-D 3.8L882: S (Ser) · Polar · K-D -0.8S883: T (Thr) · Polar · K-D -0.7T884: V (Val) · Hydrophobic · K-D 4.2V885: K (Lys) · Basic + · K-D -3.9K885886: I (Ile) · Hydrophobic · K-D 4.5I887: R (Arg) · Basic + · K-D -4.5R888: Y (Tyr) · Aromatic · K-D -1.3Y889: Y (Tyr) · Aromatic · K-D -1.3Y890: F (Phe) · Aromatic · K-D 2.8F890891: T (Thr) · Polar · K-D -0.7T892: K (Lys) · Basic + · K-D -3.9K893: D (Asp) · Acidic − · K-D -3.5D894: G (Gly) · Special · K-D -0.4G895: A (Ala) · Hydrophobic · K-D 1.8A895896: D (Asp) · Acidic − · K-D -3.5D897: Q (Gln) · Polar · K-D -3.5Q898: M (Met) · Hydrophobic · K-D 1.9M899: T (Thr) · Polar · K-D -0.7T900: F (Phe) · Aromatic · K-D 2.8F900901: W (Trp) · Aromatic · K-D -0.9W902: C (Cys) · Special · K-D 2.5C903: D (Asp) · Acidic − · K-D -3.5D904: Y (Tyr) · Aromatic · K-D -1.3Y905: A (Ala) · Hydrophobic · K-D 1.8A905906: E (Glu) · Acidic − · K-D -3.5E907: M (Met) · Hydrophobic · K-D 1.9M908: G (Gly) · Special · K-D -0.4G909: T (Thr) · Polar · K-D -0.7T910: A (Ala) · Hydrophobic · K-D 1.8A910911: N (Asn) · Polar · K-D -3.5N912: V (Val) · Hydrophobic · K-D 4.2V913: E (Glu) · Acidic − · K-D -3.5E914: G (Gly) · Special · K-D -0.4G915: T (Thr) · Polar · K-D -0.7T915916: F (Phe) · Aromatic · K-D 2.8F917: V (Val) · Hydrophobic · K-D 4.2V918: T (Thr) · Polar · K-D -0.7T919: V (Val) · Hydrophobic · K-D 4.2V920: N (Asn) · Polar · K-D -3.5N920921: P (Pro) · Special · K-D -1.6P922: A (Ala) · Hydrophobic · K-D 1.8A923: K (Lys) · Basic + · K-D -3.9K924: G (Gly) · Special · K-D -0.4G925: T (Thr) · Polar · K-D -0.7T925926: A (Ala) · Hydrophobic · K-D 1.8A927: D (Asp) · Acidic − · K-D -3.5D928: T (Thr) · Polar · K-D -0.7T929: Y (Tyr) · Aromatic · K-D -1.3Y930: L (Leu) · Hydrophobic · K-D 3.8L930931: E (Glu) · Acidic − · K-D -3.5E932: I (Ile) · Hydrophobic · K-D 4.5I933: S (Ser) · Polar · K-D -0.8S934: F (Phe) · Aromatic · K-D 2.8F935: K (Lys) · Basic + · K-D -3.9K935936: S (Ser) · Polar · K-D -0.8S937: G (Gly) · Special · K-D -0.4G938: A (Ala) · Hydrophobic · K-D 1.8A939: G (Gly) · Special · K-D -0.4G940: S (Ser) · Polar · K-D -0.8S940941: L (Leu) · Hydrophobic · K-D 3.8L942: A (Ala) · Hydrophobic · K-D 1.8A943: A (Ala) · Hydrophobic · K-D 1.8A944: G (Gly) · Special · K-D -0.4G945: A (Ala) · Hydrophobic · K-D 1.8A945946: E (Glu) · Acidic − · K-D -3.5E947: T (Thr) · Polar · K-D -0.7T948: G (Gly) · Special · K-D -0.4G949: V (Val) · Hydrophobic · K-D 4.2V950: I (Ile) · Hydrophobic · K-D 4.5I950951: Q (Gln) · Polar · K-D -3.5Q952: A (Ala) · Hydrophobic · K-D 1.8A953: R (Arg) · Basic + · K-D -4.5R954: F (Phe) · Aromatic · K-D 2.8F955: S (Ser) · Polar · K-D -0.8S955956: K (Lys) · Basic + · K-D -3.9K957: N (Asn) · Polar · K-D -3.5N958: N (Asn) · Polar · K-D -3.5N959: W (Trp) · Aromatic · K-D -0.9W960: S (Ser) · Polar · K-D -0.8S960961: N (Asn) · Polar · K-D -3.5N962: F (Phe) · Aromatic · K-D 2.8F963: D (Asp) · Acidic − · K-D -3.5D964: L (Leu) · Hydrophobic · K-D 3.8L965: S (Ser) · Polar · K-D -0.8S965966: N (Asn) · Polar · K-D -3.5N967: D (Asp) · Acidic − · K-D -3.5D968: Y (Tyr) · Aromatic · K-D -1.3Y969: S (Ser) · Polar · K-D -0.8S970: Y (Tyr) · Aromatic · K-D -1.3Y970971: D (Asp) · Acidic − · K-D -3.5D972: A (Ala) · Hydrophobic · K-D 1.8A973: S (Ser) · Polar · K-D -0.8S974: K (Lys) · Basic + · K-D -3.9K975: T (Thr) · Polar · K-D -0.7T975976: A (Ala) · Hydrophobic · K-D 1.8A977: F (Phe) · Aromatic · K-D 2.8F978: A (Ala) · Hydrophobic · K-D 1.8A979: A (Ala) · Hydrophobic · K-D 1.8A980: W (Trp) · Aromatic · K-D -0.9W980981: N (Asn) · Polar · K-D -3.5N982: K (Lys) · Basic + · K-D -3.9K983: V (Val) · Hydrophobic · K-D 4.2V984: T (Thr) · Polar · K-D -0.7T985: G (Gly) · Special · K-D -0.4G985986: Y (Tyr) · Aromatic · K-D -1.3Y987: Q (Gln) · Polar · K-D -3.5Q988: G (Gly) · Special · K-D -0.4G989: N (Asn) · Polar · K-D -3.5N990: T (Thr) · Polar · K-D -0.7T990991: K (Lys) · Basic + · K-D -3.9K992: V (Val) · Hydrophobic · K-D 4.2V993: W (Trp) · Aromatic · K-D -0.9W994: G (Gly) · Special · K-D -0.4G995: L (Leu) · Hydrophobic · K-D 3.8L995996: E (Glu) · Acidic − · K-D -3.5E997: P (Pro) · Special · K-D -1.6P997
Hydrophobic moment0.05
Mean K-D hydropathy-0.31
Approx. net charge-21
Projection angle100° / residue
The pale sector marks the direction of the hydrophobic face inferred from μH. This is a projection assumption, not a measured fold.
HydrophobicAromaticPolarBasic +Acidic −Specialhydrophobic faceμH arrow → hydrophobic face

The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

Computed developability descriptors

Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.

Sequence-derived

Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.

Aliphatic index
67.62
Instability index
22.6

At or below 40 — predicted stable in vitro.

Boman index
1.31 kcal/mol
Molar extinction coefficient (280 nm)
247,410 M⁻¹·cm⁻¹

A280 (1 g/L) ≈ 2.31 · 247,535 M⁻¹·cm⁻¹ with 1 disulfide

Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.

03

Excretion / Persistence

1 records

What evidence describes clearance or persistence?

Evidence records
1
Complete canonical measurements and observations attached to this domain.
Endpoint scope
1
Formal ADMET endpoints represented for this peptide.
Matched-context analysis
0
Quantitative results that may be analysed only with scientifically compatible records.
Reported-result review
1
Qualitative, narrative, or review-first results interpreted in their source context.
Endpoints in scopeHalf Life
Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis
Quantitative results whose endpoint and context must still be matched before analysis.
0
Interpret as reported
Qualitative, narrative, or review-first findings preserved in source context.
1
Supporting context only
Reference, label, clinical, or supporting context for interpretation.
0
Review before analysis
Records whose present structure does not establish a safe analysis role.
0
Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

·
Half Life1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required
#ValueAnalysis useAssay / modelResult contextReference
1

3552 seconds

Interpret as reported

Not specified

Result: Reported point value · Molecular form: ATLPF0001054 · In Vitro · Source: Primary reference linked

Reference
04

Evidence landscape

1 records

Cross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.

Evidence landscape

A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.

ADMET domain
Eligible when context matches
Interpret as reported
Supporting context only
Review before analysis
Exposure / Absorption
0 evidence records
0
0
0
0
Distribution / Barrier
0 evidence records
0
0
0
0
Metabolic & Proteolytic Stability
0 evidence records
0
0
0
0
Excretion / Persistence
1 evidence record
0
1
0
0
Toxicity / Safety
0 evidence records
0
0
0
0
Endpoint distribution

Top evidence-bearing endpoint questions.

Half Life
1
Assay context

Broad context buckets, useful before comparing values.

Unspecified
1
Traceability

Reference-link availability for measurement-level audit.

Linked reference
1
Not linked
0
All evidence index

Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.

#ADMET domainEndpointReported valueResult typeAnalysis useAssay / modelConditionReference
1
Excretion / Persistence
Persistence
Half Life
3,552 seconds
Reported point valueInterpret as reportedNot specifiedIn Vitro
Reference
Primary reference linked
1–1 / 1
05

Product context

Product-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.

No product association in this release

This peptide is currently interpreted from sequence, structure, physicochemical, and ADMET evidence only.

Browse products
06

Identity & reference map

1 sources

Reference-level support for checking reported names, sequence notation, and peptide identity agreement.

·
Summary1 reference group
Identity type
canonical sequence
Reported notation
0
Reference groups
1
Measurements
1
ATL peptide ID
ATLPC0000948
Identity concordance
Identity concordance
Exact reported notation

Reported sequence string matches the current peptide notation.

0 / 1
Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 1
Different notation

Reported notation does not resolve to the current display sequence.

0 / 1
Source sequence not captured

No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.

1 / 1
Reported sequence notation

No source-specific sequence notation has been captured in the current identity references.

Current identity
MKGSWWRRVAMIALSAGLLAGSLSMGTGIRKADAAAGNQNYAEALQKAIYFYEAQRSGPLPASNRVEWRGNSGIQDGADVGVDLTGGWYDAGDHVKFGFPMAASATMLAWSVVEYSDGYEQAGQLEEIKDNIRWATDYFMKAHTKPNELWGQVGAGNTDHAWWGPAEVMQMNRPSFKIDASCPGSDLAAETAAALAASSIVFADDDPAYSARLLQHAKELYNFAYTYRGEYTDCITDAAAFYNSWTGYEDELAWGGAWLYLATNDSAYLSKAIAATDRWSSSGGSANWPYTWTQGWDSKHYGAQILLARITSSLNMPEATRFIQSTERNLDYWTVGVNGTRVKYTPGGLAWLDQWGSLRYAANASFISFVYSDWVSDPVKKSRYQDFAVSQMNYILGDNPRQSSYVVGYGQNAPQHPHHRTAHGSWLNNEDIPANHRHILYGAMVGGPDASDGYTDDIGDYVSNEVATDYNAGFTGALAKMNLLFGQNHQPLANFPAPEVKGDEFFVEAAIKSSGANYTEIRAQLNNRSAWPARMGDQLSFKYFLDLSEVYAAGRTVSDVQVTTSYTEGATVSQPVVVNAAQHIYAITANFGNTKIYPGGEGNYRKEVQFRITGPQGAWNASNDHSFQTLTTGTPVKSIYLPVYDAGVKVYGQEPGLTPVTVPGAPAGVQAVAGSSQVNLTWAAVSGAESYTVKRSEVSGGPYTTVATGVNGLTYTNTGLTNGTTYYYVVTAVNSAGESSGSVQVSATPQAASTVPGALTLSGTAGNAQSVLTWTTASGATTYKVQRSVAGGTYADVATGLSVLTYTDTTALNGTTYNYRIAAVNANGQTLSNVLALTPSAPPVTTGTLEVQYRSGGSGNSSNAATPQFNVKNTGTQAIDLSTVKIRYYFTKDGADQMTFWCDYAEMGTANVEGTFVTVNPAKGTADTYLEISFKSGAGSLAAGAETGVIQARFSKNNWSNFDLSNDYSYDASKTAFAAWNKVTGYQGNTKVWGLEP
Reported names
No distinct human-readable aliases are exposed.
Reference map1 reference group
Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

ReferenceSupportsReported identityRecords
Reference
Open
Persistence
Half Life
No reported alias
1 identity
1 evidence
07

Data access & reproducibility

Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.

·
Record scopePublic release
ATL peptide ID
ATLPC0000948
Identity type
canonical sequence
ADMET endpoints
1
Evidence records
1
Reference groups
1
Release view
Public release
Data access

Structured peptide profile

JSON

Peptide-specific profile used by this page, including identity and evidence context.

Open JSON

Peptide catalogue

TSV

Complete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.

Download catalogue

Measurement catalogue

TSV

Complete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.

Download measurements
Programmatic access

The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.

Open endpoint
GET /api/v1/peptides/ATLPC0000948
open
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0000948' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'
ADMETatlas
peptide evidence atlas

ADMETatlas is an open, curated atlas of ADMET evidence for therapeutic peptides — spanning developability, membrane permeability and blood–brain-barrier transport, immune-recognition context, and approved-product context. Every measurement stays linked to its original source, with stable identifiers and transparent curation, so results can be traced, cited, and reproduced.

Browse
PeptidesProductsEvidenceContext signalsDescriptors
Resource
DevelopabilityComparatorManualExplanationsStatisticsDownloadAbout
Stack
  • RDKit
  • Mol*
  • Python
  • FastAPI
  • PostgreSQL
  • Next.js
  • React
  • TypeScript
  • Tailwind CSS
  • Apache ECharts
© 2026 ADMETatlas, an academic peptide ADMET evidence atlas.