Peptide·plain sequence-like

ATLPC0001459

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC

Routes

Compare in workbench Download release API JSON

Length
40 aa
Monoisotopic mass
4288.0 Da
Net charge @ pH 7.4
-2.90
Isoelectric point
4.41
GRAVY
-0.612

Coveragecounts only · not riskATLPC0001459

Measurements
13
Endpoints
2
Domains
2/5
Products
—

4 stability measurements
9 clearance measurements
No immunogenicity context
2 liability motifs

Jump to domain

Open the matching evidence section below

All evidence index · 13

Exposure / Absorption

No evidence

Distribution / Barrier

No evidence

Metabolic & Proteolytic Stability

4 measurements

Excretion / Persistence

9 measurements

Toxicity / Safety

No evidence

Sequence & molecular identity

1 forms

Reviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.

Sequence & peptidoform

Identity summaryCanonical sequence only

Identity status: Canonical sequence only
Residues: 40
Peptidoform features: 0
Documented molecular forms: 1
Representations: 2

Documented molecular forms1 form linked to this peptide identity

Form	Topology	Modifications	Connections	Representations	Measurements
ATLPF0001620	—	—	—	Notation only	13

Residue view

Residue display

40 residues

H1G2E3G4T5F6T7S8D9L10S11K12Q13M14E15E16E17A18V19R20L21F22I23E24W25L26K27N28G29G30P31S32S33G34A35P36P37P38S39C40

Side-chain classNonpolarPolarBasic (+)Acidic (−)Modified

Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.

Peptidoform features

Features are shown only when a reported notation or topology record supports them.

No terminal modification, residue-level marker, disulfide, staple, coordination, or other topology signal is currently available.

Structure & chemistry

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure referencesnone attached

3D structure not available

A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.

Covalent topology & modificationsnone

Exact topology not established

No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.

Physicochemical profile

4 descriptors

Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.

Core descriptors40 aa · pI 4.4 · GRAVY -0.61

Length: 40 aa
Monoisotopic mass: 4288.02 Da
Average mass: 4290.75 Da
Net charge at pH 7.4: -2.90
Estimated pI: 4.41
GRAVY: -0.612
KD-positive residues: 27.5%
Aromatic residues: 7.5%

Developability interpretation

Ionization context: pH 7.4 separated from pI
Hydrophobicity balance: Leans hydrophilic
Amphipathic moment (μH): 0.56
Computation boundary: Standard-sequence only

Charge & residue composition

pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2

4.92

pH 5

-1.36

pH 6

-2.17

pH 7.4

-3.02

pH 9

-4.50

pH 12

-7.12

Residue-class composition

Grouped composition is often more interpretable than a long amino-acid list.

Acidic (D,E)

6 · 15.0%

Basic (K,R,H)

4 · 10.0%

Polar uncharged (N,Q,S,T)

9 · 22.5%

Hydrophobic aliphatic (A,V,I,L,M)

8 · 20.0%

Aromatic (F,W,Y)

3 · 7.5%

Conformational / sulfur (G,P,C)

10 · 25.0%

Top residues

E512.5%G512.5%S512.5%P410.0%L37.5%A25.0%K25.0%F25.0%

Hydropathy & amphipathic windows

Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window

17-23

EAVRLFI

GRAVY 1.300

Most hydrophilic window

11-17

SKQMEEE

GRAVY -2.400

34 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.

Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

12 aa window

17-28

EAVRLFIEWLKN

μH 1.99 · charge 0.0

12 aa window

16-27

EEAVRLFIEWLK

μH 1.87 · charge -1.0

12 aa window

18-29

AVRLFIEWLKNG

μH 1.69 · charge 1.0

15 aa window

17-31

EAVRLFIEWLKNGGP

μH 1.66 · charge 0.0

15 aa window

16-30

EEAVRLFIEWLKNGG

μH 1.61 · charge -1.0

Sequence-liability cues

Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Asn deamidation motif

NG · pos 28

Asn followed by small/polar residues is a known sequence context to review for deamidation susceptibility.

Oxidation-sensitive residues

M, W, C · pos 14, 25, 40

Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.

Alpha-helix amphipathic projection

Helical wheel · Edmundson projection

μ_H = 0.56100°/residue · 40 aa

Hydrophobic moment0.56

Mean K-D hydropathy-0.61

Approx. net charge-3

Projection angle100° / residue

The pale sector marks the direction of the hydrophobic face inferred from μ_H. This is a projection assumption, not a measured fold.

HydrophobicAromaticPolarBasic +Acidic −Specialhydrophobic faceμ_H arrow → hydrophobic face

The projection assumes an α-helix conformation; a long μ_H arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

Computed developability descriptors

Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.

Sequence-derived

Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.

Aliphatic index

51.25

Instability index

70.9

Above 40 — predicted unstable in vitro.

Boman index

1.59 kcal/mol

Molar extinction coefficient (280 nm)

5,500 M⁻¹·cm⁻¹

A280 (1 g/L) ≈ 1.28

Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.

Metabolic & Proteolytic Stability

4 records

How stable is the peptide in biological matrices or protease systems?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeSerum/plasma stability

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Serum/plasma stability4 records · 4 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	234.2 Hours 843120 seconds	Eligible when experimental context matches	RP-HPLC · mouse · CLP-induced septic mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Dose/window: 200 μg/mL · Mice plasma protease · In Vitro · Source: Primary reference linked	Reference
2	69.7 Hours 250920 seconds	Eligible when experimental context matches	RP-HPLC · mouse · CLP-induced septic mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Dose/window: 200 μg/mL · Mice plasma protease · In Vitro · Source: Primary reference linked	Reference
3	69.2 Hours 249120 seconds	Eligible when experimental context matches	RP-HPLC · mouse · CLP-induced septic mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Dose/window: 200 μg/mL · Mice plasma protease · In Vitro · Source: Primary reference linked	Reference
4	62.8 Hours 226080 seconds	Eligible when experimental context matches	RP-HPLC · mouse · CLP-induced septic mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Dose/window: 200 μg/mL · Mice plasma protease · In Vitro · Source: Primary reference linked	Reference

Excretion / Persistence

9 records

What evidence describes clearance or persistence?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeHalf Life

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Half Life9 records · 4 matched-context · 5 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	systemic pk half life unspecified phase: 31.7 ± 1.5 Hours 114120 seconds	Eligible when experimental context matches	ELISA · rat · SD rats serum	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Time: Blood samples were collected at 0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 48, 72,96, and 144 h · SD rats serum protease · In Vivo · Source: Primary reference linked	Reference
2	systemic pk half life unspecified phase: 31.4 ± 1.6 Hours 113040 seconds	Eligible when experimental context matches	ELISA · rat · SD rats serum	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Time: Blood samples were collected at 0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 48, 72,96, and 144 h · SD rats serum protease · In Vivo · Source: Primary reference linked	Reference
3	systemic pk half life unspecified phase: 30.7 ± 2.2 Hours 110520 seconds	Eligible when experimental context matches	ELISA · rat · SD rats serum	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Time: Blood samples were collected at 0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 48, 72,96, and 144 h · SD rats serum protease · In Vivo · Source: Primary reference linked	Reference
4	systemic pk half life unspecified phase: 5.1 Hours 18360 seconds	Eligible when experimental context matches	Fluorescence assay · mouse · Nude mice serum	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Dose/window: 1 mg/ml · Time: Fluorescence intensity was monitored in nude mice by non-invasive live imaging at 0, 1, 2, 4, 8, 24, and 48 h · Nude mice serum protease · In Vivo · Source: Primary reference linked	Reference
5	systemic pk half life unspecified phase: 27.6 ± 5.1 Hours 99360 seconds	Use only explicitly reported fields	ELISA · rat · SD rats serum	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC, Multiple doses · SD rats serum protease · In Vivo · Source: Primary reference linked	Reference
6	systemic pk half life unspecified phase: 36.28 ± 7.01 Hours 130608 seconds	Use only explicitly reported fields	Exendin-4 EIA · mouse · DB/DB mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · DB/DB mice plasma protease · In Vivo · Source: Primary reference linked	Reference
7	absorption half life: 22320 seconds	Use only explicitly reported fields	Fluorescence assay · mouse · Mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Mice plasma protease · In Vivo · Source: Primary reference linked	Reference
8	absorption half life: 32400 seconds	Use only explicitly reported fields	Fluorescence assay · mouse · Mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Mice plasma protease · In Vivo · Source: Primary reference linked	Reference
9	absorption half life: 27360 seconds	Use only explicitly reported fields	Fluorescence assay · mouse · Mice plasma	Result: Reported point value · Molecular form: ATLPF0001620 · Route: SC · Mice plasma protease · In Vivo · Source: Primary reference linked	Reference

Evidence landscape

13 records

Cross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.

Evidence landscape

A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.

ADMET domain

Eligible when context matches

Interpret as reported

Supporting context only

Review before analysis

Exposure / Absorption

0 evidence records

Distribution / Barrier

0 evidence records

Metabolic & Proteolytic Stability

4 evidence records

Excretion / Persistence

9 evidence records

Toxicity / Safety

0 evidence records

Endpoint distribution

Top evidence-bearing endpoint questions.

Half Life

Serum Plasma Stability

Assay context

Broad context buckets, useful before comparing values.

In vivo / route

Traceability

Reference-link availability for measurement-level audit.

Linked reference

Not linked

All evidence index

Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.

DomainAnalysis useReferenceSpeciesMatrix

#	ADMET domain	Endpoint	Reported value	Result type	Analysis use	Assay / model	Condition	Reference
1	Excretion / Persistence Persistence	Half Life	31.7 ± 1.5 Hours 114,120 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Eligible when experimental context matches	ELISA · rat · SD rats serum	Route: SC · Time: Blood samples were collected at 0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 48, 72,96, and 144 h · Protease: SD rats serum protease · In Vivo	Reference Primary reference linked
2	Excretion / Persistence Persistence	Half Life	22,320 seconds Result metric: ABSORPTION_HALF_LIFE	Reported point value	Use only explicitly reported fields	Fluorescence assay · mouse · Mice plasma	Route: SC · Protease: Mice plasma protease · In Vivo	Reference Primary reference linked
3	Excretion / Persistence Persistence	Half Life	5.1 Hours 18,360 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Eligible when experimental context matches	Fluorescence assay · mouse · Nude mice serum	Route: SC · Time: Fluorescence intensity was monitored in nude mice by non-invasive live imaging at 0, 1, 2, 4, 8, 24, and 48 h · Dose/window: 1 mg/ml · Protease: Nude mice serum protease ·...	Reference Primary reference linked
4	Metabolic & Proteolytic Stability Stability	Serum Plasma Stability	234.2 Hours 843,120 seconds	Reported point value	Eligible when experimental context matches	RP-HPLC · mouse · CLP-induced septic mice plasma	Dose/window: 200 μg/mL · Protease: Mice plasma protease · In Vitro	Reference Primary reference linked
5	Excretion / Persistence Persistence	Half Life	31.4 ± 1.6 Hours 113,040 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Eligible when experimental context matches	ELISA · rat · SD rats serum	Route: SC · Time: Blood samples were collected at 0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 48, 72,96, and 144 h · Protease: SD rats serum protease · In Vivo	Reference Primary reference linked
6	Excretion / Persistence Persistence	Half Life	36.28 ± 7.01 Hours 130,608 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Use only explicitly reported fields	Exendin-4 EIA · mouse · DB/DB mice plasma	Route: SC · Protease: DB/DB mice plasma protease · In Vivo	Reference Primary reference linked
7	Metabolic & Proteolytic Stability Stability	Serum Plasma Stability	69.7 Hours 250,920 seconds	Reported point value	Eligible when experimental context matches	RP-HPLC · mouse · CLP-induced septic mice plasma	Dose/window: 200 μg/mL · Protease: Mice plasma protease · In Vitro	Reference Primary reference linked
8	Excretion / Persistence Persistence	Half Life	32,400 seconds Result metric: ABSORPTION_HALF_LIFE	Reported point value	Use only explicitly reported fields	Fluorescence assay · mouse · Mice plasma	Route: SC · Protease: Mice plasma protease · In Vivo	Reference Primary reference linked
9	Excretion / Persistence Persistence	Half Life	27.6 ± 5.1 Hours 99,360 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Use only explicitly reported fields	ELISA · rat · SD rats serum	Route: SC, Multiple doses · Protease: SD rats serum protease · In Vivo	Reference Primary reference linked
10	Excretion / Persistence Persistence	Half Life	27,360 seconds Result metric: ABSORPTION_HALF_LIFE	Reported point value	Use only explicitly reported fields	Fluorescence assay · mouse · Mice plasma	Route: SC · Protease: Mice plasma protease · In Vivo	Reference Primary reference linked

1–10 / 13

Identity & reference map

13 sources

Reference-level support for checking reported names, sequence notation, and peptide identity agreement.

Summary5 reference groups

Identity type: canonical sequence
Reported notation: 0
Reference groups: 5
Measurements: 13
ATL peptide ID: ATLPC0001459

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

0 / 13

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 13

Different notation

Reported notation does not resolve to the current display sequence.

0 / 13

Source sequence not captured

No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.

13 / 13

Reported sequence notation

No source-specific sequence notation has been captured in the current identity references.

Current identity

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC

Reported names

No distinct human-readable aliases are exposed.

Reference map5 reference groups

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
Reference Open	Stability Serum Plasma Stability	No reported alias	4 identity 4 evidence
Reference Open	Persistence Half Life	No reported alias	4 identity 4 evidence
Reference Open	Persistence Half Life	No reported alias	3 identity 3 evidence
Reference Open	Persistence Half Life	No reported alias	1 identity 1 evidence
Reference Open	Persistence Half Life	No reported alias	1 identity 1 evidence

Data access & reproducibility

Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.

Record scopePublic release

ATL peptide ID: ATLPC0001459
Identity type: canonical sequence
ADMET endpoints: 2
Evidence records: 13
Reference groups: 5
Release view: Public release

Data access

Structured peptide profile

JSON

Peptide-specific profile used by this page, including identity and evidence context.

Open JSON

Peptide catalogue

TSV

Complete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.

Download catalogue

Measurement catalogue

TSV

Complete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.

Download measurements

Programmatic access

The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.

Open endpoint

GET /api/v1/peptides/ATLPC0001459

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0001459' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'

Form

Topology

Modifications

Connections

Representations

Measurements

ATLPF0001620

—

Notation only

Value

Analysis use

Assay / model

Result context

Reference

234.2 Hours

843120 seconds

Eligible when experimental context matches

RP-HPLC · mouse · CLP-induced septic mice plasma

Result: Reported point value · Molecular form: ATLPF0001620 · Dose/window: 200 μg/mL · Mice plasma protease · In Vitro · Source: Primary reference linked