ATLPC0008097

ATLPC0008097 — ADMETatlas

Structure and chemistry interpretation

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure references1 reference

3D coordinates·Exact PDB matchexperimental

Exact PDB match·reference selected·length 30 aa·confidence experimental

Link	Method	Confidence	Match
Open

Covalent topology & modificationsnone

No explicit topology annotation

No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.

Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.

5. Metabolic & Proteolytic Stability

How stable is the peptide in biological matrices or protease systems?

Evidence summary

Measurements

Measurements, observations, and support attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Comparable measurements

Rows suitable for comparison only within matching endpoint and assay context.

Reported observations

Reviewed observations retained without being collapsed into comparable values.

Domain scope

Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.

Serum/plasma stability Protease stability

Serum/plasma stability and protease stability evidence.

Evidence interpretation

The same three research-facing layers are used across ADMETatlas.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Serum/plasma stability31 measurements · 29 comparable · 2 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	approx 2 minutes approx 120 seconds	Comparable	ELISA · mouse · Mouse plasma	DPP-IV · in vivo	Open
2	10 hours 36000 seconds	Comparable	ELISA · mouse · Mouse plasma (Intraperitoneally administered)	Dose/window: 0.1 μmol/kg · Mouse blood proteases · in vivo	Open
3	2.61 minutes 156.6 seconds	Comparable	ELISA · rat · Rat blood plasma (Intravenous injection)	Dose/window: 1 μg/kg · Rat blood proteases · in vivo	Open
4	33.36 minutes 2001.6 seconds	Comparable	ELISA · rat · Rat blood plasma (Intravenous injection)	Dose/window: 1 μg/kg · Rat blood proteases · in vivo	Open
5	9.09 minutes 545.4 seconds	Comparable	ELISA · rat · Rat blood plasma (Subcutaneous Injection)	Dose/window: 10 μg/kg · Rat blood proteases · in vivo	Open
6	21.67 minutes 1300.2 seconds	Comparable	ELISA · rat · Rat blood plasma (Subcutaneous Injection)	Dose/window: 10 μg/kg · Rat blood proteases · in vivo	Open
7	< 2 hours < 7200 seconds	Comparable	ELISA · rat · Serum of rats (Subcutaneous injection)	Dose/window: 300 μg/kg · Rat blood proteases · in vivo	Open
8	> 12 hours > 43200 seconds	Comparable	ESI-MS · Serum	Dose/window: 2 mM · Time: 12 hours · Serum proteases · in vitro	Open
9	4.7 hours 16920 seconds	Comparable	ESI-MS · Serum	Dose/window: 2 mM · Time: 12 hours · Serum proteases · in vitro	Open
10	10.3 hours 37080 seconds	Comparable	HPLC · human · Human plasma	Human plasma proteases · in vitro	Open

1–10 / 31

Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.

6. Excretion / Persistence

What evidence describes clearance or persistence?

Evidence summary

Measurements

Measurements, observations, and support attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Comparable measurements

Rows suitable for comparison only within matching endpoint and assay context.

Reported observations

Reviewed observations retained without being collapsed into comparable values.

Domain scope

Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.

Half Life

Clearance and half-life evidence.

Evidence interpretation

The same three research-facing layers are used across ADMETatlas.

Comparable measurements

Endpoint-ready rows with structured values and assay context.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Half Life48 measurements · 42 comparable · 6 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	20 hours 72000 seconds	Comparable	cAMP assay · rabbits	Route: Intravenously · Dose/window: 300-500 mg/dl · Time: 15-60 min · in vivo	Open
2	24 hours 86400 seconds	Comparable	cAMP assay · rabbits	Route: subcutaneous injection · Dose/window: 300-500 mg/dl · Time: 15-60 min · in vivo	Open
3	12.9 hours 46440 seconds	Comparable	cAMP assay · rat · rats	Route: Intravenously · Dose/window: 300-500 mg/dl · Time: 15-60 min · in vivo	Open
4	8.6 hours 30960 seconds	Comparable	cAMP assay · rat · rats	Route: subcutaneous injection · Dose/window: 300-500 mg/dl · Time: 15-60 min · in vivo	Open
5	20 minutes 1200 seconds	Comparable	ELISA · mouse · Mice (Subcutaneous injection)	DPP IV · in vivo	Open
6	4.4 hours 15840.000000000002 seconds	Comparable	ESI-MS · Purified DPP IV	Dose/window: 2 mM · Time: 12 hours · Purified DPP IV · in vitro	Open
7	> 12 hours > 43200 seconds	Comparable	ESI-MS · Purified DPP IV	Dose/window: 2 mM · Time: 12 hours · Purified DPP IV · in vitro	Open
8	3.6 ±0.2 hours 12960 seconds	Comparable	HPLC · human · GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C	Dose/window: 100μM · Time: 24 hours · Dipeptidyl peptidase-IV · in vitro	Open
9	> 24 hours > 86400 seconds	Comparable	HPLC · human · GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C	Dose/window: 100μM · Time: 24 hours · Dipeptidyl peptidase-IV · in vitro	Open
10	3.3 ±0.4 hours 11880 seconds	Comparable	HPLC · human · GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C	Dose/window: 100μM · Time: 24 hours · Dipeptidyl peptidase-IV · in vitro	Open

1–10 / 48

Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.

Identity & reference map

Summary44 reference groups

Identity type: canonical sequence
Reported notation: 1
Reference groups: 44
Measurements: 91
ATL peptide ID: ATLPC0008097

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

91 / 91

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 91

Different notation

Reported notation does not resolve to the current display sequence.

0 / 91

Reference map44 of 44 shown

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
PubMed 17904340 Open	Stability Protease Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	12 identity 12 evidence
PubMed 16586064 Open	PersistenceStability Half Life, Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	9 identity 9 evidence
PubMed 15012592 Open	PersistenceStability Half Life, Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	9 identity 9 evidence
PubMed 25039358 Open	Stability Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	6 identity 6 evidence
PubMed 15769092 Open	Stability Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	4 identity 4 evidence
Reference link Open	Persistence Half Life	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	4 identity 4 evidence
PubMed 14759771 Open	PersistenceStability Half Life, Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	4 identity 4 evidence
PubMed 32348108 Open	PersistenceStability Half Life, Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	3 identity 3 evidence
PubMed 21114599 Open	Stability Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	2 identity 2 evidence
PubMed 19403044 Open	Stability Serum Plasma Stability	No reported alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRexact	2 identity 2 evidence

1–10 / 44

Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.

Data access & reproducibility

Record scopePublic release

ATL peptide ID: ATLPC0008097
Identity type: canonical sequence
ADMET endpoints: 3
Measurements: 91
Reference groups: 44
Release view: Public release

Analysis-ready files

Peptide record

TSV

Identity, sequence, profile-level fields, and current release view metadata.

Download record

Programmatic access

The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.

Open endpoint

GET /api/v1/peptides/ATLPC0008097

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0008097' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'

Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.

Protease stability12 measurements · 12 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	1.17 ±0.08 minutes 70.19999999999999 seconds	Comparable	RP-HPLC · rat · Rat intestinal fluid	Dose/window: 200 μg/ml · Proteases in rat intestinal fluid · in vitro	Open
2	1.17 ±0.08 minutes 70.19999999999999 seconds	Comparable	RP-HPLC · rat · Rat intestinal fluid	Dose/window: 200 μg/ml · Proteases in rat intestinal fluid · in vitro	Open
3	4.34 ±0.21 minutes 260.4 seconds	Comparable	RP-HPLC · rat · Rat intestinal fluid	Dose/window: 200 μg/ml · Proteases in rat intestinal fluid · in vitro	Open
4	0.51 ±0.02 minutes 30.6 seconds	Comparable	RP-HPLC · rat · Rat intestinal fluid	Dose/window: 200 μg/ml · Proteases in rat intestinal fluid · in vitro	Open
5	0.51 ±0.02 minutes 30.6 seconds	Comparable	RP-HPLC · rat · Rat intestinal fluid	Dose/window: 200 μg/ml · Proteases in rat intestinal fluid · in vitro	Open
6	4.34 ±0.21 minutes 260.4 seconds	Comparable	RP-HPLC · rat · Rat intestinal fluid	Dose/window: 200 μg/ml · Proteases in rat intestinal fluid · in vitro	Open
7	1.34 ±0.07 minutes 80.4 seconds	Comparable	RP-HPLC · rat · Rat intestinal homogenate	Dose/window: 200 μg/ml · Proteases in rat intestinal homogenate · in vitro	Open
8	0.79 ±0.01 minutes 47.400000000000006 seconds	Comparable	RP-HPLC · rat · Rat intestinal homogenate	Dose/window: 200 μg/ml · Proteases in rat intestinal homogenate · in vitro	Open
9	2.77 ±0.05 minutes 166.2 seconds	Comparable	RP-HPLC · rat · Rat intestinal homogenate	Dose/window: 200 μg/ml · Proteases in rat intestinal homogenate · in vitro	Open
10	2.77 ±0.05 minutes 166.2 seconds	Comparable	RP-HPLC · rat · Rat intestinal homogenate	Dose/window: 200 μg/ml · Proteases in rat intestinal homogenate · in vitro	Open

1–10 / 12

ATLPC0008097

Peptide developability profile

1. Sequence & peptidoform

Sequence interpretation

2. Structure & chemistry

Structure and chemistry interpretation

3. Physicochemical profile

Computed descriptors

Computed developability descriptors

4. Product context

Translational product context

5. Metabolic & Proteolytic Stability

Evidence summary

6. Excretion / Persistence

Evidence summary

7. Evidence landscape

Evidence landscape and measurement index

8. Identity & reference map

Identity & reference map

9. Data access & reproducibility

Data access & reproducibility

Peptide record

Evidence table

Structured record