ATLPC0008797
ATLPC0008797
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFTDHLFNI…
- Length1 aa
- Measurements10
- Endpoints1
- Domains1/5
- Products—
- No matrix stability evidence
- 10 clearance measurements
- No immunogenicity context
- No sequence liability cues
Open the matching evidence section below
Sequence & molecular identity
1 formsReviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.
Sequence & peptidoform
A peptidoform is one specific molecular form of the peptide — its sequence plus the modifications at given positions (HUPO-PSI term). This view preserves the reported terminal groups, residue modifications, and stereo markers from the source notation.
Identity summarySpecific molecular form represented
- Identity status
- Specific molecular form represented
- Residues
- 1
- Peptidoform features
- 1
- Documented molecular forms
- 1
- Representations
- 2
Documented molecular forms1 form linked to this peptide identity
| Form | Topology | Modifications | Connections | Representations | Measurements | |
|---|---|---|---|---|---|---|
| ATLPF0009630 | — | — | — | Notation only | 10 |
Residue view
Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.
Features are shown only when a reported notation or topology record supports them.
Reported token MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSPAGSPTSTEEGSPAGSPTSTEEGTSTEPSEGSAPGTSESATPESGPGTSESATPESGPGTSESATPESGPGSEPATSGSETPGSEPATSGSETPGSPAGSPTSTEEGTSTEPSEGSAPGTSTEPSEGSAPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPASSEITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLYDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG/MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPGTSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDHSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDLRIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRYIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCAAFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYEAEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSPAGSPTSTEEGSPAGSPTSTEEGASSDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG is not one of the 20 standard residue symbols in this display.
Reported sequence notation was converted to parent-residue display for visualization; the original notation remains shown below.
Structure & chemistry
Chemical representationsequence / HELM only
How the current release can interpret this identity chemically.
modified or textualResidue string used for positional interpretation when available.
XPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
3D structure referencesnone attached
A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.
Covalent topology & modificationsnone
No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.
Physicochemical profile
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.
These descriptors require a standard parent-residue sequence. The module remains visible so modified or unresolved identities are not forced into unreliable computed values.
Excretion / Persistence
10 recordsWhat evidence describes clearance or persistence?
Evidence interpretation
Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
Half Life10 records · 10 matched-context · 0 as reported · 0 context only · 0 review required
| # | Value | Analysis use | Assay / model | Result context | Reference |
|---|---|---|---|---|---|
| 1 | systemic pk half life unspecified phase: 33.6 Hours 120960 seconds | Eligible when experimental context matches | Chromogenic activity assays · monkey · Cynomolgus monkeys plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · Cynomolgus monkeys plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 2 | systemic pk half life unspecified phase: 32.7 Hours 117720.00000000001 seconds | Eligible when experimental context matches | Chromogenic activity assays · monkey · Cynomolgus monkeys plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · Cynomolgus monkeys plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 3 | systemic pk half life unspecified phase: 26.9 Hours 96840 seconds | Eligible when experimental context matches | chromogenic activity assays · mouse · DKO mice plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · DKO mice plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 4 | systemic pk half life unspecified phase: 31.8 Hours 114480 seconds | Eligible when experimental context matches | chromogenic activity assays · mouse · HemA mice plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · HemA mice plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 5 | systemic pk half life unspecified phase: 25 Hours 90000 seconds | Eligible when experimental context matches | Chromogenic activity assays · mouse · HemA mice plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · HemA mice plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 6 | systemic pk half life unspecified phase: 31 Hours 111600 seconds | Eligible when experimental context matches | Chromogenic activity assays · mouse · HemA mice plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · HemA mice plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 7 | systemic pk half life unspecified phase: 30 Hours 108000 seconds | Eligible when experimental context matches | Chromogenic activity assays · mouse · HemA mice plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · HemA mice plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 8 | systemic pk half life unspecified phase: 29.9 Hours 107640 seconds | Eligible when experimental context matches | chromogenic activity assays · mouse · VWF Het mice plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · VWF Het mice plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 9 | systemic pk half life unspecified phase: 29.3 Hours 105480 seconds | Eligible when experimental context matches | ELISA · monkey · Cynomolgus monkeys plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · Cynomolgus monkeys plasma protease · In Vivo · Source: Primary reference linked | Reference |
| 10 | systemic pk half life unspecified phase: 34 Hours 122400 seconds | Eligible when experimental context matches | ELISA · monkey · Cynomolgus monkeys plasma | Result: Reported point value · Molecular form: ATLPF0009630 · Route: IV · Cynomolgus monkeys plasma protease · In Vivo · Source: Primary reference linked | Reference |
Evidence landscape
10 recordsCross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.
A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.
Top evidence-bearing endpoint questions.
Broad context buckets, useful before comparing values.
Reference-link availability for measurement-level audit.
Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.
| # | ADMET domain | Endpoint | Reported value | Result type | Analysis use | Assay / model | Condition | Reference |
|---|---|---|---|---|---|---|---|---|
| 1 | Excretion / Persistence Persistence | Half Life | 29.9 Hours 107,640 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | chromogenic activity assays · mouse · VWF Het mice plasma | Route: IV · Protease: VWF Het mice plasma protease · In Vivo | Reference Primary reference linked |
| 2 | Excretion / Persistence Persistence | Half Life | 33.6 Hours 120,960 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | Chromogenic activity assays · monkey · Cynomolgus monkeys plasma | Route: IV · Protease: Cynomolgus monkeys plasma protease · In Vivo | Reference Primary reference linked |
| 3 | Excretion / Persistence Persistence | Half Life | 29.3 Hours 105,480 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | ELISA · monkey · Cynomolgus monkeys plasma | Route: IV · Protease: Cynomolgus monkeys plasma protease · In Vivo | Reference Primary reference linked |
| 4 | Excretion / Persistence Persistence | Half Life | 31.8 Hours 114,480 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | chromogenic activity assays · mouse · HemA mice plasma | Route: IV · Protease: HemA mice plasma protease · In Vivo | Reference Primary reference linked |
| 5 | Excretion / Persistence Persistence | Half Life | 25 Hours 90,000 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | Chromogenic activity assays · mouse · HemA mice plasma | Route: IV · Protease: HemA mice plasma protease · In Vivo | Reference Primary reference linked |
| 6 | Excretion / Persistence Persistence | Half Life | 26.9 Hours 96,840 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | chromogenic activity assays · mouse · DKO mice plasma | Route: IV · Protease: DKO mice plasma protease · In Vivo | Reference Primary reference linked |
| 7 | Excretion / Persistence Persistence | Half Life | 32.7 Hours 117,720 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | Chromogenic activity assays · monkey · Cynomolgus monkeys plasma | Route: IV · Protease: Cynomolgus monkeys plasma protease · In Vivo | Reference Primary reference linked |
| 8 | Excretion / Persistence Persistence | Half Life | 31 Hours 111,600 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | Chromogenic activity assays · mouse · HemA mice plasma | Route: IV · Protease: HemA mice plasma protease · In Vivo | Reference Primary reference linked |
| 9 | Excretion / Persistence Persistence | Half Life | 34 Hours 122,400 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | ELISA · monkey · Cynomolgus monkeys plasma | Route: IV · Protease: Cynomolgus monkeys plasma protease · In Vivo | Reference Primary reference linked |
| 10 | Excretion / Persistence Persistence | Half Life | 30 Hours 108,000 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE | Reported point value | Eligible when experimental context matches | Chromogenic activity assays · mouse · HemA mice plasma | Route: IV · Protease: HemA mice plasma protease · In Vivo | Reference Primary reference linked |
Product context
Product-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.
This peptide is currently interpreted from sequence, structure, physicochemical, and ADMET evidence only.
Identity & reference map
10 sourcesReference-level support for checking reported names, sequence notation, and peptide identity agreement.
Summary1 reference group
- Identity type
- reported modified sequence
- Reported notation
- 0
- Reference groups
- 1
- Measurements
- 10
- ATL peptide ID
- ATLPC0008797
Identity concordance
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.
No source-specific sequence notation has been captured in the current identity references.
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSPAGSPTSTEEGSPAGSPTSTEEGTSTEPSEGSAPGTSESATPESGPGTSESATPESGPGTSESATPESGPGSEPATSGSETPGSEPATSGSETPGSPAGSPTSTEEGTSTEPSEGSAPGTSTEPSEGSAPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPASSEITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLYDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG/MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPGTSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDHSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDLRIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRYIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCAAFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYEAEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSPAGSPTSTEEGSPAGSPTSTEEGASSDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Reference map1 reference group
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
Reference | Persistence Half Life | No reported alias | 10 identity 10 evidence |
Data access & reproducibility
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Record scopePublic release
- ATL peptide ID
- ATLPC0008797
- Identity type
- reported modified sequence
- ADMET endpoints
- 1
- Evidence records
- 10
- Reference groups
- 1
- Release view
- Public release
Data access
Structured peptide profile
JSONPeptide-specific profile used by this page, including identity and evidence context.
Peptide catalogue
TSVComplete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.
Measurement catalogue
TSVComplete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.
Programmatic access
The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0008797' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'