Peptide·plain sequence-like
Exenatide
ATLPC0009237
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Routes
- Length39 aa
- Monoisotopic mass
ATLPC0009237
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
What safety, toxicity, or tolerability evidence is attached?
Normalized for positional visualization, not a replacement for the reported modified notation.
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Original notation retained for interpretation and comparison.
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
| Link |
|---|
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Modeled net charge across common formulation and assay pH checkpoints.
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
A280 (1 g/L) ≈ 1.31
Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Serum/plasma stability and protease stability evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 19.1 hours 68760 seconds | Comparable | EIA · rat · Rat plasma (Subcutaneous) | Dose/window: 520 micro g/Kg · in vivo | Not linked |
| 2 | 1.3 Hours 4680 seconds | Comparable | ELISA · human · Human plasma | Route: Multiple doses · Dose/window: 10 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 3 | 1.6 Hours 5760 seconds | Comparable | ELISA · human · Human plasma | Route: Multiple doses · Dose/window: 10 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 4 | 1.8 Hours 6480 seconds | Comparable | ELISA · human · Human plasma | Route: Multiple doses · Dose/window: 10 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 5 | 1.3 Hours 4680 seconds | Comparable | ELISA · human · Human plasma | Route: Multiple doses · Dose/window: 5 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 6 | 1.9 Hours 6840 seconds | Comparable | ELISA · human · Human plasma | Route: Multiple doses · Dose/window: 5 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 7 | 1.8 Hours 6480 seconds | Comparable | ELISA · human · Human plasma | Route: Single dose · Dose/window: 5 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 8 | 1.6 Hours 5760 seconds | Comparable | ELISA · human · Human plasma | Route: Single dose · Dose/window: 5 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 9 | 1.9 Hours 6840 seconds | Comparable | ELISA · human · Human plasma with Metformin | Route: Multiple doses · Dose/window: 5 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
| 10 | 1.8 Hours 6480 seconds | Comparable | ELISA · human · Human plasma with Metformin | Route: Single dose · Dose/window: 5 μg · Time: Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25... · Human plasma protease · In Vivo | Open |
Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.
Reviewed observations retained without being collapsed into comparable values.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 2.2 Hours 7920.000000000001 seconds | Comparable | In vivo imaging system · mouse · Mouse body | Route: SC · Dose/window: 20 μg · Time: The fluorescence images of the mice were measured at 0, 1, 2, 4, 8, 12, 24, 48, 72, 96, and 147 h after injec... · Mouse body protease · In Vivo | Open |
| 2 | > 4 Hours > 14400 seconds | Comparable | LC-HRMS · human · 1 mg/ml human SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · Human SCT protease · In Vitro | Open |
| 3 | > 4 Hours > 14400 seconds | Comparable | LC-HRMS · porcine · 1 mg/ml göttingen minipigs SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · Göttingen minipigs SCT protease · In Vitro | Open |
| 4 | > 4 Hours > 14400 seconds | Comparable | LC-HRMS · rat · 1 mg/ml SD rats SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · SD rats SCT protease · In Vitro | Open |
| 5 | 61 hours 219600 seconds | Comparable | modified · blood | Not specified | Not linked |
| 6 | 0.7 hours 2520 seconds | Comparable | natural · blood | Not specified | Not linked |
| 7 | 32.8 ±4.1 minutes 1967.9999999999998 seconds | Comparable | Radioactivity measurement · porcine · (Bolus injection)Pig kidney | Dose/window: 10 pmol/kg · Time: Blood sample collected after 50-130 minutes after the infusion of peptide · Pig kidneys proteases · in vivo | Open |
| 8 | 28.4 ±1.7 minutes 1704 seconds | Comparable | Radioactivity measurement · porcine · (Bolus injection)Pig kidney | Dose/window: 20 pmol/kg · Time: Blood sample collected after 42-130 minutes after the infusion of peptide · Pig kidneys proteases · in vivo | Open |
| 9 | 56.7 hours 204120 seconds | Comparable | Radioimmunoassay · monkey · Monkey (Intravenous injection) | Dose/window: 4.0 mg/kg · in vivo | Open |
| 10 | 77.4 hours 278640 seconds | Comparable | Radioimmunoassay · monkey · Monkey (Subcutaneous injection) | Dose/window: 4.0 mg/kg · in vivo | Open |
Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
PubMed 36630826 | Stability Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 24 identity 24 evidence |
PubMed 38288338 | Stability Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 13 identity 13 evidence |
PubMed 28932995 | Stability Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 9 identity 9 evidence |
PubMed 26725426 | Stability Protease Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 8 identity 8 evidence |
PubMed 28605180 | Stability Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 5 identity 5 evidence |
PubMed 31479925 | Stability Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 4 identity 4 evidence |
PubMed 21244372 | Stability Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 4 identity 4 evidence |
PubMed 38789061 | PersistenceStability Half Life, Serum Plasma Stability | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 3 identity 3 evidence |
PubMed 30041153 | Persistence Half Life | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 3 identity 3 evidence |
PubMed 17994612 | Persistence Half Life | No reported alias HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSexact | 2 identity 2 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0009237' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
Features are shown only when a reported notation or topology record supports them.
| Method |
|---|
| Confidence |
|---|
| Match |
|---|
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match |
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 14.28 Hours 51408 seconds | Comparable | Mass spectrometry · Gastric fluid solution (pH 1.2) with Pepsin (0.2 U/mL) | Dose/window: 23.88 nmol/mL · Pepsin · In Vitro | Open |
| 2 | 3.53 Hours 12708 seconds | Comparable | Mass spectrometry · Intestinal fluid buffer (pH 6.8) with APN (0.2 U/mL) | Dose/window: 23.88 nmol/mL · Aminopeptidase N · In Vitro | Open |
| 3 | 0.05784 Hours 208.22400000000002 seconds | Comparable | Mass spectrometry · Intestinal fluid buffer (pH 6.8) with Chymotrypsin (0.2 U/mL) | Dose/window: 23.88 nmol/mL · Chymotrypsin · In Vitro | Open |
| 4 | 10.16 Hours 36576 seconds | Comparable | Mass spectrometry · Intestinal fluid buffer (pH 6.8) with CPA (0.2 U/mL) | Dose/window: 23.88 nmol/mL · Carboxy-Peptidase A · In Vitro | Open |
| 5 | 12.38 Hours 44568 seconds | Comparable | Mass spectrometry · Intestinal fluid buffer (pH 6.8) with Trypsin (0.2 U/mL) | Dose/window: 23.88 nmol/mL · Trypsin · In Vitro | Open |
| 6 | 1.718 Hours 6184.8 seconds | Comparable | Ultraviolet spectroscopy · Intestinal duodenum homogenate | Dose/window: 100 μg/mL · Time: 37°C · Intestinal duodenum homogenate protease · In Vitro | Open |
| 7 | 1.229 Hours 4424.400000000001 seconds | Comparable | Ultraviolet spectroscopy · Intestinal ileum homogenate | Dose/window: 100 μg/mL · Time: 37°C · Intestinal ileum homogenate protease · In Vitro | Open |
| 8 | 1.462 Hours 5263.2 seconds | Comparable | Ultraviolet spectroscopy · Intestinal jejunum homogenate | Dose/window: 100 μg/mL · Time: 37°C · Intestinal jejunum homogenate protease · In Vitro | Open |
These endpoints are listed for this peptide, but no value, assay context, or reference is available for them in this view.
The identity reference does not expose a sequence string.
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
| 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 97.4% identity |
| Open | Sequence match | experimental | 97.4% identity |
| Open | Sequence match | experimental | 96.7% identity |
| Open | Experimental structure match | experimental | 39 aa |
| Open | Experimental structure match | experimental | 39 aa |