Peptide·plain sequence-like

Nesiritide

ATLPC0010885

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Routes

Compare in workbench Download release API JSON

Length
32 aa
Monoisotopic mass
3463.8 Da
Net charge @ pH 7.4
6.10
Isoelectric point
11.58
GRAVY
-0.506

Sequence & molecular identity

1 forms

Reviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.

Sequence & peptidoform

Identity summaryCanonical sequence only

Identity status: Canonical sequence only
Residues: 32
Peptidoform features: 0
Documented molecular forms: 1
Representations: 2

Documented molecular forms1 form linked to this peptide identity

Form	Topology	Modifications	Connections	Representations	Measurements
ATLPF0011940	—	—	—	Notation only	14

Residue view

Residue display

32 residues

S1P2K3M4V5Q6G7S8G9C10F11G12R13K14M15D16R17I18S19S20S21S22G23L24G25C26K27V28L29R30R31H32

Secondary structureα-helix (H)β-strand (E)coil (C)

Side-chain classNonpolarPolarBasic (+)Acidic (−)Modified

Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.

Peptidoform features

Features are shown only when a reported notation or topology record supports them.

No terminal modification, residue-level marker, disulfide, staple, coordination, or other topology signal is currently available.

Structure & chemistry

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure references3 references

Structure reference·

3D coordinates·Sequence matchexperimental

Sequence match·reference selected·identity 100.0%·confidence experimental

Link	Method	Confidence	Match
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Homology model	predicted	32 aa

Covalent topology & modificationsnone

Exact topology not established

No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.

Physicochemical profile

4 descriptors

Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.

Core descriptors32 aa · pI 11.6 · GRAVY -0.51

Length: 32 aa
Monoisotopic mass: 3463.75 Da
Average mass: 3466.08 Da
Net charge at pH 7.4: 6.10
Estimated pI: 11.58
GRAVY: -0.506
KD-positive residues: 31.3%
Aromatic residues: 3.1%

Developability interpretation

Ionization context: pH 7.4 separated from pI
Hydrophobicity balance: Leans hydrophilic
Amphipathic moment (μH): 0.84
Computation boundary: Standard-sequence only

Charge & residue composition

pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2

8.96

pH 5

7.08

pH 6

6.76

pH 7.4

5.90

pH 9

3.72

pH 12

-0.78

Residue-class composition

Grouped composition is often more interpretable than a long amino-acid list.

Acidic (D,E)

1 · 3.1%

Basic (K,R,H)

8 · 25.0%

Polar uncharged (N,Q,S,T)

7 · 21.9%

Hydrophobic aliphatic (A,V,I,L,M)

7 · 21.9%

Aromatic (F,W,Y)

1 · 3.1%

Conformational / sulfur (G,P,C)

8 · 25.0%

Top residues

S618.8%G515.6%R412.5%K39.4%C26.3%L26.3%M26.3%V26.3%

Hydropathy & amphipathic windows

Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window

23-29

GLGCKVL

GRAVY 1.371

Most hydrophilic window

11-17

FGRKMDR

GRAVY -1.729

26 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.

Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

12 aa window

9-20

GCFGRKMDRISS

μH 1.38 · charge 2.0

12 aa window

11-22

FGRKMDRISSSS

μH 1.38 · charge 2.0

12 aa window

10-21

CFGRKMDRISSS

μH 1.35 · charge 2.0

15 aa window

4-18

MVQGSGCFGRKMDRI

μH 1.31 · charge 2.0

15 aa window

3-17

KMVQGSGCFGRKMDR

μH 1.29 · charge 3.0

Sequence-liability cues

Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Oxidation-sensitive residues

M, C · pos 4, 10, 15, 26

Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.

Cys covalent complexity

C · pos 10, 26

Multiple cysteines can indicate disulfide or free-thiol interpretation requirements.

Alpha-helix amphipathic projection

Helical wheel · Edmundson projection

μ_H = 0.84100°/residue · 32 aa

Hydrophobic moment0.84

Mean K-D hydropathy-0.51

Approx. net charge+6

Projection angle100° / residue

The pale sector marks the direction of the hydrophobic face inferred from μ_H. This is a projection assumption, not a measured fold.

HydrophobicAromaticPolarBasic +Acidic −Specialhydrophobic faceμ_H arrow → hydrophobic face

The projection assumes an α-helix conformation; a long μ_H arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

Computed developability descriptors

Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.

Sequence-derived

Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.

Aliphatic index

54.69

Instability index

86.8

Above 40 — predicted unstable in vitro.

Boman index

2.43 kcal/mol

Molar extinction coefficient (280 nm)

0 M⁻¹·cm⁻¹

A280 (1 g/L) ≈ 0.00 · 125 M⁻¹·cm⁻¹ with 1 disulfide

Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.

Exposure / Absorption

1 records

What evidence describes systemic exposure or absorption?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeBioavailability

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Bioavailability1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	Observation As a peptide, nesiritide has poor bioavailability and therefore is only available for intravenous administration.	Interpret as reported	Not specified	Result: Qualitative or narrative result · Molecular form: not reported · Route: IV · 15 · Nesiritide · exact product name match · exact or normalized match · Source: Primary reference linked	Source record

Distribution / Barrier

2 records

What is known about distribution, binding, permeability, or barrier crossing?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeVd

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Vd2 records · 0 matched-context · 2 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	~ 0.073 L/kg	Use only explicitly reported fields	human	Result: Approximate quantitative measurement · Molecular form: not reported · Nesiritide· 12.3 Pharmacokinetics · nesiritide central volume of distribution vc · In the... · Source: Primary reference linked	Reference
2	0.19 L/kg	Use only explicitly reported fields	human	Result: Reported point value · Molecular form: not reported · Nesiritide· 12.3 Pharmacokinetics · nesiritide steady state volume of distribution vss ·... · Source: Primary reference linked	Reference

Barrier and permeability assay context

PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.

PAMPA

artificial membrane

Caco-2

cell monolayer

MDCK

cell monolayer

RRCK

cell monolayer

BBB

barrier evidence

Metabolic & Proteolytic Stability

2 records

How stable is the peptide in biological matrices or protease systems?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeSerum/plasma stability

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Serum/plasma stability2 records · 2 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	approx 22 minutes approx 1320 seconds	Eligible when experimental context matches	ELISA · human · Human plasma	Result: Approximate quantitative measurement · Molecular form: ATLPF0011940 · Human blood proteases · in vitro · Source: Primary reference linked	Reference
2	12.1 ±3.0 minutes 726 seconds	Eligible when experimental context matches	Radioimmunoassay · human · Human blood plasma	Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vitro · Source: Primary reference linked	Reference

Excretion / Persistence

14 records

What evidence describes clearance or persistence?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeHalf Life Clearance

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Clearance1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	~ 9.2 mL/min/kg	Use only explicitly reported fields	human	Result: Approximate quantitative measurement · Molecular form: not reported · Nesiritide· 12.3 Pharmacokinetics · nesiritide mean clearance cl · In these patients, the... · Source: Primary reference linked	Reference

Half Life13 records · 4 matched-context · 7 as reported · 0 context only · 2 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	systemic pk half life unspecified phase: 3.1 minutes 186 seconds	Eligible when experimental context matches	EIA · mouse · Mice plasma (Intravenous injection)	Result: Reported point value · Molecular form: ATLPF0011940 · in vivo · Source: Primary reference linked	Reference
2	systemic pk half life unspecified phase: 11.2 hours 40320 seconds	Eligible when experimental context matches	EIA · mouse · Mice plasma (Intravenous injection)	Result: Reported point value · Molecular form: ATLPF0011940 · Mouse blood proteases · in vivo · Source: Primary reference linked	Reference
3	systemic pk half life unspecified phase: 19.3 hours 69480 seconds	Eligible when experimental context matches	EIA · mouse · Mice plasma (Subcutaneous injection)	Result: Reported point value · Molecular form: ATLPF0011940 · Mouse blood proteases · in vivo · Source: Primary reference linked	Reference
4	systemic pk half life unspecified phase: 3.1 minutes 186 seconds	Eligible when experimental context matches	ELISA · mouse · Mouse plasma	Result: Reported point value · Molecular form: ATLPF0011940 · Dose/window: 31.2ng/ml · Mouse plasma proteases · in vivo · Source: Primary reference linked	Reference
5	234 seconds	Interpret as reported	Not specified	Result: Reported point value · Molecular form: ATLPF0011940 · in vitro · Source: Primary reference linked	Reference
6	1242 seconds	Interpret as reported	Not specified	Result: Reported point value · Molecular form: ATLPF0011940 · in vitro · Source: Primary reference linked	Reference
7	8 minutes 480 seconds	Use only explicitly reported fields	human · Human kidney membrane extract	Result: Reported point value · Molecular form: ATLPF0041045 · Human kidney proteases · in vitro · Source: Primary reference linked	Reference
8	systemic pk half life unspecified phase: 6.6 ±1.3 minutes 396 seconds	Use only explicitly reported fields	human · Human plasma (Normal humans given infusion of metoprolol)	Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vivo · Source: Primary reference linked	Reference
9	systemic pk half life unspecified phase: 5.7 ±0.8 minutes 342 seconds	Use only explicitly reported fields	human · Human plasma (Normal humans)	Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vivo · Source: Primary reference linked	Reference
10	systemic pk half life unspecified phase: 5.6 ±0.45 minutes 336 seconds	Use only explicitly reported fields	human · Human plasma of patients with mild, stable heart failure	Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vivo · Source: Primary reference linked	Reference

1–10 / 13

Evidence landscape

19 records

Cross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.

Evidence landscape

A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.

ADMET domain

Eligible when context matches

Interpret as reported

Supporting context only

Review before analysis

Exposure / Absorption

1 evidence record

Distribution / Barrier

2 evidence records

Metabolic & Proteolytic Stability

2 evidence records

Excretion / Persistence

14 evidence records

Toxicity / Safety

0 evidence records

Endpoint distribution

Top evidence-bearing endpoint questions.

Half Life

Serum Plasma Stability

Volume Of Distribution

Bioavailability

Clearance

Assay context

Broad context buckets, useful before comparing values.

In vivo / route

Unspecified

Clinical / product

Traceability

Reference-link availability for measurement-level audit.

Linked reference

Not linked

All evidence index

Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.

DomainAnalysis useReferenceSpeciesMatrixRoute

#	ADMET domain	Endpoint	Reported value	Result type	Analysis use	Assay / model	Condition	Reference
1	Excretion / Persistence Persistence	Half Life	19.3 hours 69,480 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Eligible when experimental context matches	EIA · mouse · Mice plasma (Subcutaneous injection)	Protease: Mouse blood proteases · in vivo	Reference Primary reference linked
2	Excretion / Persistence Persistence	Half Life	3.1 minutes 186 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Eligible when experimental context matches	EIA · mouse · Mice plasma (Intravenous injection)	in vivo	Reference Primary reference linked
3	Excretion / Persistence Persistence	Half Life	8 minutes 480 seconds	Reported point value	Use only explicitly reported fields	human · Human kidney membrane extract	Protease: Human kidney proteases · in vitro	Reference Primary reference linked
4	Excretion / Persistence Persistence	Half Life	11.2 hours 40,320 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Eligible when experimental context matches	EIA · mouse · Mice plasma (Intravenous injection)	Protease: Mouse blood proteases · in vivo	Reference Primary reference linked
5	Excretion / Persistence Persistence	Half Life	3.1 minutes 186 seconds	Reported point value	Review experimental context before comparison	Not specified	Not specified	Reference Primary reference linked
6	Excretion / Persistence Persistence	Half Life	6.6 ±1.3 minutes 396 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Use only explicitly reported fields	human · Human plasma (Normal humans given infusion of metoprolol)	Protease: Human blood proteases · in vivo	Reference Primary reference linked
7	Excretion / Persistence Persistence	Half Life	234 seconds	Reported point value	Interpret as reported	Not specified	in vitro	Reference Primary reference linked
8	Metabolic & Proteolytic Stability Stability	Serum Plasma Stability	approx 22 minutes approx 1,320 seconds	Approximate quantitative measurement	Eligible when experimental context matches	ELISA · human · Human plasma	Protease: Human blood proteases · in vitro	Reference Primary reference linked
9	Metabolic & Proteolytic Stability Stability	Serum Plasma Stability	12.1 ±3.0 minutes 726 seconds	Reported point value	Eligible when experimental context matches	Radioimmunoassay · human · Human blood plasma	Protease: Human blood proteases · in vitro	Reference Primary reference linked
10	Excretion / Persistence Persistence	Half Life	5.7 ±0.8 minutes 342 seconds Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE	Reported point value	Use only explicitly reported fields	human · Human plasma (Normal humans)	Protease: Human blood proteases · in vivo	Reference Primary reference linked

1–10 / 19

Product context

1 products

Product-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.

Summary1 linked product

Linked products: 1
Label context: None
Clinical trials: 48
Safety label cues: None

Linked products1 shown

Nesiritide

Human brain natriuretic peptide (hBNP)Human BNP

Peptide-product match

Reviewed peptide match

Route / product class

Intravenous

Clinical context

48 trial records · 7 exact intervention matches · 10 with results · latest 2026-03-30

Label safety context

No label safety cue linked

View product

Identity & reference map

19 sources

Reference-level support for checking reported names, sequence notation, and peptide identity agreement.

Summary10 reference groups

Identity type: canonical sequence
Reported notation: 1
Reference groups: 10
Measurements: 19
ATL peptide ID: ATLPC0010885

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

1 / 19

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 19

Different notation

Reported notation does not resolve to the current display sequence.

0 / 19

Source sequence not captured

No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.

18 / 19

Reported sequence notation

Exact1 reference

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Current identity

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Reported names

No distinct human-readable aliases are exposed.

Reference map10 reference groups

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
Reference Open	Persistence Half Life	No reported alias	4 identity 4 evidence
Reference Open	Persistence Half Life	No reported alias	3 identity 3 evidence
Reference Open	DistributionPersistence Clearance, Volume Of Distribution	No reported alias	3 identity 3 evidence
Reference Open	Persistence Half Life	No reported alias	2 identity 2 evidence
Reference Open	Persistence Half Life	No reported alias	2 identity 2 evidence
Reference Open	Persistence Half Life	No reported alias	1 identity 1 evidence
Reference Open	Stability Serum Plasma Stability	No reported alias	1 identity 1 evidence
Reference Open	Persistence Half Life	No reported alias	1 identity 1 evidence
Reference Open	Stability Serum Plasma Stability	No reported alias	1 identity 1 evidence
Source record Open	Exposure Bioavailability	No reported alias SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHexact	1 identity 1 evidence

Data access & reproducibility

Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.

Record scopePublic release

ATL peptide ID: ATLPC0010885
Identity type: canonical sequence
ADMET endpoints: 5
Evidence records: 19
Reference groups: 10
Release view: Public release

Data access

Structured peptide profile

JSON

Peptide-specific profile used by this page, including identity and evidence context.

Open JSON

Peptide catalogue

TSV

Complete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.

Download catalogue

Measurement catalogue

TSV

Complete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.

Download measurements

Programmatic access

The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.

Open endpoint

GET /api/v1/peptides/ATLPC0010885

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0010885' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'

Form

Topology

Modifications

Connections

Representations

Measurements

ATLPF0011940

—

Notation only

Link

Method

Confidence

Match

Open

Sequence match

experimental

100.0% identity

Open

Sequence match

experimental

100.0% identity

Open

Homology model

predicted

32 aa

Value

Analysis use

Assay / model

Result context

Reference

Observation

As a peptide, nesiritide has poor bioavailability and therefore is only available for intravenous administration.

Interpret as reported

Not specified

Result: Qualitative or narrative result · Molecular form: not reported · Route: IV · 15 · Nesiritide · exact product name match · exact or normalized match · Source: Primary reference linked

Source record

Value

Analysis use

Assay / model

Result context

Reference

~ 0.073 L/kg

Use only explicitly reported fields

human

Result: Approximate quantitative measurement · Molecular form: not reported · Nesiritide· 12.3 Pharmacokinetics · nesiritide central volume of distribution vc · In the... · Source: Primary reference linked

Reference

0.19 L/kg

Use only explicitly reported fields

human

Result: Reported point value · Molecular form: not reported · Nesiritide· 12.3 Pharmacokinetics · nesiritide steady state volume of distribution vss ·... · Source: Primary reference linked

Reference

Value

Analysis use

Assay / model

Result context

Reference

approx 22 minutes

approx 1320 seconds

Eligible when experimental context matches

ELISA · human · Human plasma

Result: Approximate quantitative measurement · Molecular form: ATLPF0011940 · Human blood proteases · in vitro · Source: Primary reference linked

Reference

12.1 ±3.0 minutes

726 seconds

Eligible when experimental context matches

Radioimmunoassay · human · Human blood plasma

Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vitro · Source: Primary reference linked

Reference

Value

Analysis use

Assay / model

Result context

Reference

~ 9.2 mL/min/kg

Use only explicitly reported fields

human

Result: Approximate quantitative measurement · Molecular form: not reported · Nesiritide· 12.3 Pharmacokinetics · nesiritide mean clearance cl · In these patients, the... · Source: Primary reference linked

Reference

Value

Analysis use

Assay / model

Result context

Reference

systemic pk half life unspecified phase: 3.1 minutes

186 seconds

Eligible when experimental context matches

EIA · mouse · Mice plasma (Intravenous injection)

Result: Reported point value · Molecular form: ATLPF0011940 · in vivo · Source: Primary reference linked

Reference

systemic pk half life unspecified phase: 11.2 hours

40320 seconds

Eligible when experimental context matches

EIA · mouse · Mice plasma (Intravenous injection)

Result: Reported point value · Molecular form: ATLPF0011940 · Mouse blood proteases · in vivo · Source: Primary reference linked

Reference

systemic pk half life unspecified phase: 19.3 hours

69480 seconds

Eligible when experimental context matches

EIA · mouse · Mice plasma (Subcutaneous injection)

Result: Reported point value · Molecular form: ATLPF0011940 · Mouse blood proteases · in vivo · Source: Primary reference linked

Reference

systemic pk half life unspecified phase: 3.1 minutes

186 seconds

Eligible when experimental context matches

ELISA · mouse · Mouse plasma

Result: Reported point value · Molecular form: ATLPF0011940 · Dose/window: 31.2ng/ml · Mouse plasma proteases · in vivo · Source: Primary reference linked

Reference

234 seconds

Interpret as reported

Not specified

Result: Reported point value · Molecular form: ATLPF0011940 · in vitro · Source: Primary reference linked

Reference

1242 seconds

Interpret as reported

Not specified

Result: Reported point value · Molecular form: ATLPF0011940 · in vitro · Source: Primary reference linked

Reference

8 minutes

480 seconds

Use only explicitly reported fields

human · Human kidney membrane extract

Result: Reported point value · Molecular form: ATLPF0041045 · Human kidney proteases · in vitro · Source: Primary reference linked

Reference

systemic pk half life unspecified phase: 6.6 ±1.3 minutes

396 seconds

Use only explicitly reported fields

human · Human plasma (Normal humans given infusion of metoprolol)

Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vivo · Source: Primary reference linked

Reference

systemic pk half life unspecified phase: 5.7 ±0.8 minutes

342 seconds

Use only explicitly reported fields

human · Human plasma (Normal humans)

Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vivo · Source: Primary reference linked

Reference

systemic pk half life unspecified phase: 5.6 ±0.45 minutes

336 seconds

Use only explicitly reported fields

human · Human plasma of patients with mild, stable heart failure

Result: Reported point value · Molecular form: ATLPF0011940 · Human blood proteases · in vivo · Source: Primary reference linked

Reference

ADMET domain

Endpoint

Reported value

Result type

Analysis use

Assay / model

Condition

Reference

Excretion / Persistence

Persistence

Half Life

19.3 hours

69,480 seconds

Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE

Reported point value

Eligible when experimental context matches

EIA · mouse · Mice plasma (Subcutaneous injection)

Protease: Mouse blood proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

3.1 minutes

186 seconds

Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE

Reported point value

Eligible when experimental context matches

EIA · mouse · Mice plasma (Intravenous injection)

in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

8 minutes

480 seconds

Reported point value

Use only explicitly reported fields

human · Human kidney membrane extract

Protease: Human kidney proteases · in vitro

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

11.2 hours

40,320 seconds

Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE

Reported point value

Eligible when experimental context matches

EIA · mouse · Mice plasma (Intravenous injection)

Protease: Mouse blood proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

3.1 minutes

186 seconds

Reported point value

Review experimental context before comparison

Not specified

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

6.6 ±1.3 minutes

396 seconds

Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE

Reported point value

Use only explicitly reported fields

human · Human plasma (Normal humans given infusion of metoprolol)

Protease: Human blood proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

234 seconds

Reported point value

Interpret as reported

Not specified

in vitro

Reference

Primary reference linked

Metabolic & Proteolytic Stability

Stability

Serum Plasma Stability

approx 22 minutes

approx 1,320 seconds

Approximate quantitative measurement

Eligible when experimental context matches

ELISA · human · Human plasma

Protease: Human blood proteases · in vitro

Reference

Primary reference linked

Metabolic & Proteolytic Stability

Stability

Serum Plasma Stability

12.1 ±3.0 minutes

726 seconds

Reported point value

Eligible when experimental context matches

Radioimmunoassay · human · Human blood plasma

Protease: Human blood proteases · in vitro

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

5.7 ±0.8 minutes

342 seconds

Result metric: SYSTEMIC_PK_HALF_LIFE_UNSPECIFIED_PHASE

Reported point value

Use only explicitly reported fields

human · Human plasma (Normal humans)

Protease: Human blood proteases · in vivo

Reference

Primary reference linked

Reference

Supports

Reported identity

Records

Reference

Open

Persistence

Half Life

No reported alias

4 identity

4 evidence

Reference

Open

Persistence

Half Life

No reported alias

3 identity

3 evidence

Reference

Open

DistributionPersistence

Clearance, Volume Of Distribution

No reported alias

3 identity

3 evidence

Reference

Open

Persistence

Half Life

No reported alias

2 identity

2 evidence

Reference

Open

Persistence

Half Life

No reported alias

2 identity

2 evidence

Reference

Open

Persistence

Half Life

No reported alias

1 identity

1 evidence

Reference

Open

Stability

Serum Plasma Stability

No reported alias

1 identity

1 evidence

Reference

Open

Persistence

Half Life

No reported alias

1 identity

1 evidence

Reference

Open

Stability

Serum Plasma Stability

No reported alias

1 identity

1 evidence

Source record

Open

Exposure

Bioavailability

No reported alias

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHexact

1 identity

1 evidence