Peptide·plain sequence-like

ATLPC0031403

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Compare in workbench Download release API JSON

Length
41 aa
Monoisotopic mass
4668.5 Da
Net charge @ pH 7.4
-1.80
Isoelectric point
5.52
GRAVY
-0.322

Coveragecounts only · not riskATLPC0031403

Measurements
16
Endpoints
1
Domains
1/5
Products
—

No matrix stability evidence
16 clearance measurements
No immunogenicity context
1 liability motif

Jump to domain

Open the matching evidence section below

All evidence index · 16

Exposure / Absorption

No evidence

Distribution / Barrier

No evidence

Metabolic & Proteolytic Stability

No evidence

Excretion / Persistence

16 measurements

Toxicity / Safety

No evidence

Sequence & molecular identity

1 forms

Reviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.

Sequence & peptidoform

Identity summaryCanonical sequence only

Identity status: Canonical sequence only
Residues: 41
Peptidoform features: 0
Documented molecular forms: 1
Representations: 2

Documented molecular forms1 form linked to this peptide identity

Form	Topology	Modifications	Connections	Representations	Measurements
ATLPF0034115	—	—	—	Notation only	16

Residue view

Residue display

41 residues

S1Q2E3P4P5I6S7L8D9L10T11F12H13L14L15R16E17V18L19E20M21T22K23A24D25Q26L27A28Q29Q30A31H32S33N34R35K36L37L38D39I40A41

Side-chain classNonpolarPolarBasic (+)Acidic (−)Modified

Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.

Peptidoform features

Features are shown only when a reported notation or topology record supports them.

No terminal modification, residue-level marker, disulfide, staple, coordination, or other topology signal is currently available.

Structure & chemistry

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure referencesnone attached

3D structure not available

A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.

Covalent topology & modificationsnone

Exact topology not established

No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.

Physicochemical profile

4 descriptors

Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.

Core descriptors41 aa · pI 5.5 · GRAVY -0.32

Length: 41 aa
Monoisotopic mass: 4668.47 Da
Average mass: 4671.35 Da
Net charge at pH 7.4: -1.80
Estimated pI: 5.52
GRAVY: -0.322
KD-positive residues: 41.5%
Aromatic residues: 2.4%

Developability interpretation

Ionization context: pH 7.4 separated from pI
Hydrophobicity balance: Leans hydrophilic
Amphipathic moment (μH): 0.25
Computation boundary: Standard-sequence only

Charge & residue composition

pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2

6.91

pH 5

0.53

pH 6

-0.42

pH 7.4

-1.83

pH 9

-2.74

pH 12

-5.36

Residue-class composition

Grouped composition is often more interpretable than a long amino-acid list.

Acidic (D,E)

6 · 14.6%

Basic (K,R,H)

6 · 14.6%

Polar uncharged (N,Q,S,T)

10 · 24.4%

Hydrophobic aliphatic (A,V,I,L,M)

16 · 39.0%

Aromatic (F,W,Y)

1 · 2.4%

Conformational / sulfur (G,P,C)

2 · 4.9%

Top residues

L819.5%A49.8%Q49.8%D37.3%E37.3%S37.3%R24.9%H24.9%

Hydropathy & amphipathic windows

Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window

6-12

ISLDLTF

GRAVY 1.414

Most hydrophilic window

30-36

QAHSNRK

GRAVY -2.514

35 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.

Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

12 aa window

9-20

DLTFHLLREVLE

μH 1.88 · charge -1.9

12 aa window

12-23

FHLLREVLEMTK

μH 1.85 · charge 0.1

12 aa window

13-24

HLLREVLEMTKA

μH 1.81 · charge 0.1

12 aa window

8-19

LDLTFHLLREVL

μH 1.78 · charge -0.9

12 aa window

11-22

TFHLLREVLEMT

μH 1.66 · charge -0.9

Sequence-liability cues

Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Oxidation-sensitive residues

M · pos 21

Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.

Alpha-helix amphipathic projection

Helical wheel · Edmundson projection

μ_H = 0.25100°/residue · 41 aa

Hydrophobic moment0.25

Mean K-D hydropathy-0.32

Approx. net charge-2

Projection angle100° / residue

The pale sector marks the direction of the hydrophobic face inferred from μ_H. This is a projection assumption, not a measured fold.

HydrophobicAromaticPolarBasic +Acidic −Specialhydrophobic faceμ_H arrow → hydrophobic face

The projection assumes an α-helix conformation; a long μ_H arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

Computed developability descriptors

Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.

Sequence-derived

Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.

Aliphatic index

111.95

Instability index

34.0

At or below 40 — predicted stable in vitro.

Boman index

1.83 kcal/mol

Molar extinction coefficient (280 nm)

0 M⁻¹·cm⁻¹

A280 (1 g/L) ≈ 0.00

Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.

Excretion / Persistence

16 records

What evidence describes clearance or persistence?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeHalf Life

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Half Life16 records · 16 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	terminal elimination phase half life: 1962.0000000000002 seconds	Eligible when experimental context matches	Radioimmunoassay · monkey · Rhesus monkey plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Time: Blood samples collected at 1-180 minutes after peptide injection · Rhesus monkey proteases · in vivo · Source: Primary reference linked	Reference
2	terminal elimination phase half life: 1740 seconds	Eligible when experimental context matches	Radioimmunoassay · monkey · Rhesus monkey plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Time: Blood samples collected at 1-180 minutes after peptide injection · Rhesus monkey proteases · in vivo · Source: Primary reference linked	Reference
3	distribution initial phase half life: 762 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 75 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
4	distribution initial phase half life: 744 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 75 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
5	terminal elimination phase half life: 5724 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 75 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
6	terminal elimination phase half life: 5448 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 75 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
7	terminal elimination phase half life: 4248 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 76 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
8	distribution initial phase half life: 972 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 76 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
9	distribution initial phase half life: 564 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 80 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference
10	terminal elimination phase half life: 4380 seconds	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 80 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked	Reference

1–10 / 16

Evidence landscape

16 records

Cross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.

Evidence landscape

A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.

ADMET domain

Eligible when context matches

Interpret as reported

Supporting context only

Review before analysis

Exposure / Absorption

0 evidence records

Distribution / Barrier

0 evidence records

Metabolic & Proteolytic Stability

0 evidence records

Excretion / Persistence

16 evidence records

Toxicity / Safety

0 evidence records

Endpoint distribution

Top evidence-bearing endpoint questions.

Half Life

Assay context

Broad context buckets, useful before comparing values.

In vivo / route

Traceability

Reference-link availability for measurement-level audit.

Linked reference

Not linked

All evidence index

Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.

DomainAnalysis useReferenceSpecies

#	ADMET domain	Endpoint	Reported value	Result type	Analysis use	Assay / model	Condition	Reference
1	Excretion / Persistence Persistence	Half Life	762 seconds Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 75 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
2	Excretion / Persistence Persistence	Half Life	336 seconds Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 90 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
3	Excretion / Persistence Persistence	Half Life	4,248 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 76 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
4	Excretion / Persistence Persistence	Half Life	798 seconds Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 85 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
5	Excretion / Persistence Persistence	Half Life	744 seconds Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 75 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
6	Excretion / Persistence Persistence	Half Life	1,962 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay · monkey · Rhesus monkey plasma	Time: Blood samples collected at 1-180 minutes after peptide injection · Protease: Rhesus monkey proteases · in vivo	Reference Primary reference linked
7	Excretion / Persistence Persistence	Half Life	564 seconds Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 80 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
8	Excretion / Persistence Persistence	Half Life	5,724 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 75 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
9	Excretion / Persistence Persistence	Half Life	4,380 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 80 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked
10	Excretion / Persistence Persistence	Half Life	2,874 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Eligible when experimental context matches	Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma	Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 90 μg · Protease: Human blood plasma proteases · in vivo	Reference Primary reference linked

1–10 / 16

Identity & reference map

16 sources

Reference-level support for checking reported names, sequence notation, and peptide identity agreement.

Summary2 reference groups

Identity type: canonical sequence
Reported notation: 0
Reference groups: 2
Measurements: 16
ATL peptide ID: ATLPC0031403

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

0 / 16

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 16

Different notation

Reported notation does not resolve to the current display sequence.

0 / 16

Source sequence not captured

No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.

16 / 16

Reported sequence notation

No source-specific sequence notation has been captured in the current identity references.

Current identity

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Reported names

No distinct human-readable aliases are exposed.

Reference map2 reference groups

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
Reference Open	Persistence Half Life	No reported alias	14 identity 14 evidence
Reference Open	Persistence Half Life	No reported alias	2 identity 2 evidence

Data access & reproducibility

Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.

Record scopePublic release

ATL peptide ID: ATLPC0031403
Identity type: canonical sequence
ADMET endpoints: 1
Evidence records: 16
Reference groups: 2
Release view: Public release

Data access

Structured peptide profile

JSON

Peptide-specific profile used by this page, including identity and evidence context.

Open JSON

Peptide catalogue

TSV

Complete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.

Download catalogue

Measurement catalogue

TSV

Complete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.

Download measurements

Programmatic access

The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.

Open endpoint

GET /api/v1/peptides/ATLPC0031403

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0031403' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'

Form

Topology

Modifications

Connections

Representations

Measurements

ATLPF0034115

—

Notation only

Value

Analysis use

Assay / model

Result context

Reference

terminal elimination phase half life: 1962.0000000000002 seconds

Eligible when experimental context matches

Radioimmunoassay · monkey · Rhesus monkey plasma

Result: Reported point value · Molecular form: ATLPF0034115 · Time: Blood samples collected at 1-180 minutes after peptide injection · Rhesus monkey proteases · in vivo · Source: Primary reference linked

Reference

terminal elimination phase half life: 1740 seconds

Eligible when experimental context matches

Radioimmunoassay · monkey · Rhesus monkey plasma

Reference

distribution initial phase half life: 762 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 75 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked

Reference

distribution initial phase half life: 744 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Reference

terminal elimination phase half life: 5724 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Reference

terminal elimination phase half life: 5448 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Reference

terminal elimination phase half life: 4248 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 76 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked

Reference

distribution initial phase half life: 972 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Reference

distribution initial phase half life: 564 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Result: Reported point value · Molecular form: ATLPF0034115 · Dose/window: 80 μg · Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Human blood plasma proteases · in vivo · Source: Primary reference linked

Reference

terminal elimination phase half life: 4380 seconds

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Reference

ADMET domain

Endpoint

Reported value

Result type

Analysis use

Assay / model

Condition

Reference

Excretion / Persistence

Persistence

Half Life

762 seconds

Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 75 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

336 seconds

Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 90 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

4,248 seconds

Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 76 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

798 seconds

Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 85 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

744 seconds

Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 75 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

1,962 seconds

Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay · monkey · Rhesus monkey plasma

Time: Blood samples collected at 1-180 minutes after peptide injection · Protease: Rhesus monkey proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

564 seconds

Result metric: DISTRIBUTION_INITIAL_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 80 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

5,724 seconds

Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 75 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

4,380 seconds

Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 80 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Excretion / Persistence

Persistence

Half Life

2,874 seconds

Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE

Reported point value

Eligible when experimental context matches

Radioimmunoassay and HPLC analysis · human · Intravenous administration to human plasma

Time: 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. · Dose/window: 90 μg · Protease: Human blood plasma proteases · in vivo

Reference

Primary reference linked

Reference

Supports

Reported identity

Records

Reference

Open

Persistence

Half Life

No reported alias

14 identity

14 evidence

Reference

Open

Persistence

Half Life

No reported alias

2 identity

2 evidence

ATLPC0031403

Sequence & molecular identity

Sequence & peptidoform

Structure & chemistry

Physicochemical profile

Computed developability descriptors

Excretion / Persistence

Evidence landscape

Product context

Identity & reference map

Data access & reproducibility

Structured peptide profile

Peptide catalogue

Measurement catalogue

ATLPC0031403

Sequence & molecular identity

Sequence & peptidoform

Structure & chemistry

Physicochemical profile

Computed developability descriptors

Excretion / Persistence

Evidence landscape

Product context

Identity & reference map

Data access & reproducibility

Structured peptide profile

Peptide catalogue

Measurement catalogue