Ecallantide
ATLPC0035849
H-Glu-Ala-Met-His-Ser-Phe-Cys(1)-Ala-Phe-Lys-Ala-Asp-Asp-Gly-Pro-Cys(2)-Arg-Ala-…
- Length69 aa
ATLPC0035849
H-Glu-Ala-Met-His-Ser-Phe-Cys(1)-Ala-Phe-Lys-Ala-Asp-Asp-Gly-Pro-Cys(2)-Arg-Ala-…
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
Can basic developability descriptors be computed?
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
What safety, toxicity, or tolerability evidence is attached?
Can every measurement be reviewed in one cross-domain table?
Can the peptide identity be checked against reported names, sequence notation, and reference links?
Reported sequence notation was converted to parent-residue display for visualization; the original notation remains shown below.
Features are shown only when a reported notation or topology record supports them.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
Normalized for positional visualization, not a replacement for the reported modified notation.
HEAMHSFCAFKADDGPCRAAHPRWFFNIFATHRRQCEEFIYGGCEGNQNRFESLEECKKMCATHRRDXH
Original notation retained for interpretation and comparison.
H-Glu-Ala-Met-His-Ser-Phe-Cys(1)-Ala-Phe-Lys-Ala-Asp-Asp-Gly-Pro-Cys(2)-Arg-Ala-Ala-His-Pro-Arg-Trp-Phe-Phe-Asn-Ile-Phe-aThr-Arg-Gln-Cys(3)-Glu-Glu-Phe-Ile-Tyr-Gly-Gly-Cys(2)-Glu-Gly-Asn-Gln-Asn-Arg-Phe-Glu-Ser-Leu-Glu-Glu-Cys(3)-Lys-Lys-Met-Cys(1)-aThr-Arg-Asp-OH
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
HEAMHSFCAFKADDGPCRAAHPRWFFNIFATHRRQCEEFIYGGCEGNQNRFESLEECKKMCATHRRDXHPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
3 Ro5 violations · MW 7,053.95 Da
Identity, sequence, profile-level fields, and current release view metadata.
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0035849' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
Reported token O is not one of the 20 standard residue symbols in this display.
Inline modification 1 is reported on parent residue H21.
Inline modification 2 is reported on parent residue N47.