Peptide·plain sequence-like

Teriparatide

ATLPC0009758

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Routes

Compare in workbench Download release API JSON

Length
34 aa
Monoisotopic mass
4115.1 Da
Net charge @ pH 7.4
1.30
Isoelectric point
9.44
GRAVY
-0.671

Coveragecounts only · not riskATLPC0009758

Measurements
18
Endpoints
7
Domains
3/5
Products
1

No matrix stability evidence
6 clearance measurements
4 immunogenicity context entries
2 liability motifs

Jump to domain

Open the matching evidence section below

All evidence index · 18

Exposure / Absorption

8 measurements

Distribution / Barrier

4 measurements

Metabolic & Proteolytic Stability

No evidence

Excretion / Persistence

6 measurements

Toxicity / Safety

No evidence

Sequence & molecular identity

1 forms

Reviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.

Sequence & peptidoform

Identity summaryCanonical sequence only

Identity status: Canonical sequence only
Residues: 34
Peptidoform features: 0
Documented molecular forms: 1
Representations: 2

Documented molecular forms1 form linked to this peptide identity

Form	Topology	Modifications	Connections	Representations	Measurements
ATLPF0010663	—	—	—	Notation only	2

Residue view

Residue display

34 residues

S1V2S3E4I5Q6L7M8H9N10L11G12K13H14L15N16S17M18E19R20V21E22W23L24R25K26K27L28Q29D30V31H32N33F34

Side-chain classNonpolarPolarBasic (+)Acidic (−)Modified

Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.

Peptidoform features

Features are shown only when a reported notation or topology record supports them.

No terminal modification, residue-level marker, disulfide, staple, coordination, or other topology signal is currently available.

Structure & chemistry

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure references10 references

Structure reference·

3D coordinates·Sequence matchexperimental

Sequence match·reference selected·identity 100.0%·confidence experimental

Link	Method	Confidence	Match
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity

Covalent topology & modificationsnone

Exact topology not established

No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.

Physicochemical profile

4 descriptors

Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.

Core descriptors34 aa · pI 9.4 · GRAVY -0.67

Length: 34 aa
Monoisotopic mass: 4115.13 Da
Average mass: 4117.76 Da
Net charge at pH 7.4: 1.30
Estimated pI: 9.44
GRAVY: -0.671
KD-positive residues: 35.3%
Aromatic residues: 5.9%

Developability interpretation

Ionization context: pH 7.4 separated from pI
Hydrophobicity balance: Leans hydrophilic
Amphipathic moment (μH): 0.30
Computation boundary: Standard-sequence only

Charge & residue composition

pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2

8.94

pH 5

4.36

pH 6

3.33

pH 7.4

1.28

pH 9

0.25

pH 12

-3.30

Residue-class composition

Grouped composition is often more interpretable than a long amino-acid list.

Acidic (D,E)

4 · 11.8%

Basic (K,R,H)

8 · 23.5%

Polar uncharged (N,Q,S,T)

8 · 23.5%

Hydrophobic aliphatic (A,V,I,L,M)

11 · 32.4%

Aromatic (F,W,Y)

2 · 5.9%

Conformational / sulfur (G,P,C)

1 · 2.9%

Top residues

L514.7%N38.8%E38.8%H38.8%K38.8%S38.8%V38.8%R25.9%

Hydropathy & amphipathic windows

Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window

2-8

VSEIQLM

GRAVY 0.943

Most hydrophilic window

24-30

LRKKLQD

GRAVY -1.671

28 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.

Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

12 aa window

22-33

EWLRKKLQDVHN

μH 2.00 · charge 1.1

12 aa window

6-17

QLMHNLGKHLNS

μH 1.97 · charge 1.2

12 aa window

21-32

VEWLRKKLQDVH

μH 1.89 · charge 1.1

12 aa window

5-16

IQLMHNLGKHLN

μH 1.89 · charge 1.2

15 aa window

6-20

QLMHNLGKHLNSMER

μH 1.87 · charge 1.2

Sequence-liability cues

Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Asn deamidation motif

NS · pos 16

Asn followed by small/polar residues is a known sequence context to review for deamidation susceptibility.

Oxidation-sensitive residues

M, W · pos 8, 18, 23

Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.

Alpha-helix amphipathic projection

Helical wheel · Edmundson projection

μ_H = 0.30100°/residue · 34 aa

Hydrophobic moment0.30

Mean K-D hydropathy-0.67

Approx. net charge+1

Projection angle100° / residue

The pale sector marks the direction of the hydrophobic face inferred from μ_H. This is a projection assumption, not a measured fold.

HydrophobicAromaticPolarBasic +Acidic −Specialhydrophobic faceμ_H arrow → hydrophobic face

The projection assumes an α-helix conformation; a long μ_H arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

Computed developability descriptors

Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.

Sequence-derived

Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.

Aliphatic index

94.41

Instability index

62.5

Above 40 — predicted unstable in vitro.

Boman index

2.30 kcal/mol

Molar extinction coefficient (280 nm)

5,500 M⁻¹·cm⁻¹

A280 (1 g/L) ≈ 1.34

Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.

Exposure / Absorption

8 records

What evidence describes systemic exposure or absorption?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeBioavailability Tmax AUC Cmax

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Bioavailability3 records · 1 matched-context · 2 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	95 %	Eligible when experimental context matches	Oral bioavailability in human · human	Result: Reported point value · Molecular form: not reported · Route: oral · bioavailability · F· Oral bioavailability in human · Exact ChEMBL pref name TERIPARATIDE... · Source: Primary reference linked	Reference
2	~ 95 %	Use only explicitly reported fields	human	Result: Approximate quantitative measurement · Molecular form: not reported · Teriparatide· 12.3 Pharmacokinetics · bioavailability single percent · the absolute bioav... · Source: Primary reference linked	Reference
3	95 %	Use only explicitly reported fields	Not specified	Result: Reported point value · Molecular form: not reported · Route: SC · 20 · Teriparatide · exact product name match · field mismatch · Source: Primary reference linked	Source record

AUC1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	Observation In 5 patients with severe renal impairment (CrCl<30 mL/minute), the AUC and T 1/2 of teriparatide were increased by 73% and 77%, respectively.	Interpret as reported	human	Result: Qualitative or narrative result · Molecular form: not reported · Teriparatide· 12.3 Pharmacokinetics · teriparatide severe renal impairment auc increase t... · Source: Primary reference linked	Reference

Cmax1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	Observation Maximum serum concentration of teriparatide was not increased.	Interpret as reported	human · serum	Result: Qualitative or narrative result · Molecular form: not reported · Teriparatide· 12.3 Pharmacokinetics · teriparatide severe renal impairment cmax not incre... · Source: Primary reference linked	Reference

Tmax3 records · 2 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	0.5 hr 1800 seconds	Eligible when experimental context matches	Tmax in human · human	Result: Reported point value · Molecular form: not reported · time to max concentration · Tmax· Tmax in human · Exact ChEMBL pref name TERIPARATIDE · h... · Source: Primary reference linked	Reference
2	0.25 hr 900 seconds	Eligible when experimental context matches	Tmax in Sprague-Dawley rat at 5 ug/kg, sc · rat	Result: Reported point value · Molecular form: not reported · Route: sc · time to max concentration · Tmax· Tmax in Sprague-Dawley rat at 5 ug/kg, sc · Exact ChEMB... · Source: Primary reference linked	Reference
3	30 minutes 1800 seconds	Use only explicitly reported fields	human · serum	Result: Reported point value · Molecular form: not reported · Route: subcutaneous · Teriparatide· 12.3 Pharmacokinetics · tmax peak serum about time · The peptide reaches pe... · Source: Primary reference linked	Reference

Distribution / Barrier

4 records

What is known about distribution, binding, permeability, or barrier crossing?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeVd

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Vd4 records · 3 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	0.12 L/kg	Eligible when experimental context matches	THPdb curated therapeutic product PK entry	Result: Reported point value · Molecular form: not reported · Route: Subcutaneous · Th1120 · Teriparatide · single value · Subcutaneous · Bone Density Conservation Agents ·... · Source: Primary reference linked	Reference
2	0.12 L/kg	Eligible when experimental context matches	THPdb curated therapeutic product PK entry	Result: Reported point value · Molecular form: not reported · Th1120 · Teriparatide · single value · N.A. · Bone Density Conservation Agents · 3 · 1557... · Source: Primary reference linked	Reference
3	0.12 L/kg	Eligible when experimental context matches	Volume of distribution in human · human	Result: Reported point value · Molecular form: not reported · volume of distribution · Vd· Volume of distribution in human · Exact ChEMBL pref name TER... · Source: Primary reference linked	Reference
4	~ 0.12 L/kg	Use only explicitly reported fields	human	Result: Approximate quantitative measurement · Molecular form: not reported · Route: intravenous · Teriparatide· 12.3 Pharmacokinetics · volume of distribution single · Distribution — Volu... · Source: Primary reference linked	Reference

Barrier and permeability assay context

PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.

PAMPA

artificial membrane

Caco-2

cell monolayer

MDCK

cell monolayer

RRCK

cell monolayer

BBB

barrier evidence

Excretion / Persistence

6 records

What evidence describes clearance or persistence?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeHalf Life Clearance

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Clearance4 records · 2 matched-context · 2 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	94 L/h	Eligible when experimental context matches	Clearance in men · human	Result: Reported point value · Molecular form: not reported · clearance · CL· Clearance in men · Exact ChEMBL pref name TERIPARATIDE · https://www.ebi.... · Source: Primary reference linked	Reference
2	62 L/h	Eligible when experimental context matches	Clearance in women · human	Result: Reported point value · Molecular form: not reported · clearance · CL· Clearance in women · Exact ChEMBL pref name TERIPARATIDE · https://www.eb... · Source: Primary reference linked	Reference
3	~ 94 L/h	Use only explicitly reported fields	human · plasma	Result: Approximate quantitative measurement · Molecular form: not reported · Teriparatide· 12.3 Pharmacokinetics · teriparatide clearance men · Elimination — Systemic... · Source: Primary reference linked	Reference
4	~ 62 L/h	Use only explicitly reported fields	human · plasma	Result: Approximate quantitative measurement · Molecular form: not reported · Teriparatide· 12.3 Pharmacokinetics · teriparatide clearance women · Elimination — System... · Source: Primary reference linked	Reference

Half Life2 records · 0 matched-context · 2 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	terminal elimination phase half life: 5400 seconds	Use only explicitly reported fields	human · Human plasma (Normal)	Result: Reported point value · Molecular form: ATLPF0010663 · Dose/window: Not available · Proteases from human plasma(Normal) · in vivo · Source: Primary reference linked	Reference
2	terminal elimination phase half life: 18000 seconds	Use only explicitly reported fields	human · Human plasma (Severe renal impairment patients)	Result: Reported point value · Molecular form: ATLPF0010663 · Dose/window: Not available · Proteases from human plasma(Severe renal impairment patients) · in vivo · Source: Primary reference linked	Reference

Evidence landscape

18 records

Cross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.

Evidence landscape

A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.

ADMET domain

Eligible when context matches

Interpret as reported

Supporting context only

Review before analysis

Exposure / Absorption

8 evidence records

Distribution / Barrier

4 evidence records

Metabolic & Proteolytic Stability

0 evidence records

Excretion / Persistence

6 evidence records

Toxicity / Safety

0 evidence records

Endpoint distribution

Top evidence-bearing endpoint questions.

Clearance

Volume Of Distribution

Bioavailability

Time To Max Concentration

Half Life

Area Under Curve

Max Concentration

Assay context

Broad context buckets, useful before comparing values.

In vivo / route

Clinical / product

Traceability

Reference-link availability for measurement-level audit.

Linked reference

Not linked

All evidence index

Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.

DomainAnalysis useReferenceSpeciesMatrixRoute

#	ADMET domain	Endpoint	Reported value	Result type	Analysis use	Assay / model	Condition	Reference
1	Excretion / Persistence Persistence	Half Life	5,400 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Use only explicitly reported fields	human · Human plasma (Normal)	Dose/window: Not available · Protease: Proteases from human plasma(Normal) · in vivo	Reference Primary reference linked
2	Excretion / Persistence Persistence	Half Life	18,000 seconds Result metric: TERMINAL_ELIMINATION_PHASE_HALF_LIFE	Reported point value	Use only explicitly reported fields	human · Human plasma (Severe renal impairment patients)	Dose/window: Not available · Protease: Proteases from human plasma(Severe renal impairment patients) · in vivo	Reference Primary reference linked
3	Distribution / Barrier Distribution	Volume Of Distribution	0.12 L/kg	Reported point value	Eligible when experimental context matches	THPdb curated therapeutic product PK entry	Route: Subcutaneous · thpdb_volume_distribution_v0_1	Reference Primary reference linked
4	Distribution / Barrier Distribution	Volume Of Distribution	0.12 L/kg	Reported point value	Eligible when experimental context matches	THPdb curated therapeutic product PK entry	thpdb_volume_distribution_v0_1 · 1558	Reference Primary reference linked
5	Exposure / Absorption Exposure	Bioavailability	95 %	Reported point value	Use only explicitly reported fields	Not specified	Route: SC	Source record Primary reference linked
6	Exposure / Absorption Exposure	Time To Max Concentration	0.5 hr 1,800 seconds	Reported point value	Eligible when experimental context matches	Tmax in human · human	chembl_activity_endpoint_review_v0_1 · ChEMBL molecule_type Protein	Reference Primary reference linked
7	Excretion / Persistence Persistence	Clearance	62 L/h	Reported point value	Eligible when experimental context matches	Clearance in women · human	chembl_activity_endpoint_review_v0_1 · ChEMBL molecule_type Protein	Reference Primary reference linked
8	Excretion / Persistence Persistence	Clearance	94 L/h	Reported point value	Eligible when experimental context matches	Clearance in men · human	chembl_activity_endpoint_review_v0_1 · ChEMBL molecule_type Protein	Reference Primary reference linked
9	Distribution / Barrier Distribution	Volume Of Distribution	0.12 L/kg	Reported point value	Eligible when experimental context matches	Volume of distribution in human · human	chembl_activity_endpoint_review_v0_1 · ChEMBL molecule_type Protein	Reference Primary reference linked
10	Exposure / Absorption Exposure	Time To Max Concentration	0.25 hr 900 seconds	Reported point value	Eligible when experimental context matches	Tmax in Sprague-Dawley rat at 5 ug/kg, sc · rat	Route: sc · chembl_activity_endpoint_review_v0_1 · ChEMBL molecule_type Protein	Reference Primary reference linked

1–10 / 18

Product context

1 products

Product-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.

Summary1 linked product

Linked products: 1
Label context: 1
Clinical trials: 33
Safety label cues: 5

Linked products1 shown

Teriparatide

FORTEOBONSITY

Peptide-product match

Reviewed peptide match

Route / product class

Subcutaneous · Bone Density Conservation Agents

Clinical context

33 trial records · 18 exact intervention matches · 8 with results · latest 2026-04-22

Label safety context

Label linked · Contraindications · Adverse reactions · Immunogenicity review

View product

Identity & reference map

18 sources

Reference-level support for checking reported names, sequence notation, and peptide identity agreement.

Summary7 reference groups

Identity type: canonical sequence
Reported notation: 1
Reference groups: 7
Measurements: 18
ATL peptide ID: ATLPC0009758

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

1 / 18

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 18

Different notation

Reported notation does not resolve to the current display sequence.

0 / 18

Source sequence not captured

No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.

17 / 18

Reported sequence notation

Exact1 reference

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Current identity

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Reported names

No distinct human-readable aliases are exposed.

Reference map7 reference groups

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
Reference Open	DistributionExposurePersistence Area Under Curve, Bioavailability, Clearance, Max Concentration +2 more	No reported alias	7 identity 7 evidence
Reference Open	DistributionExposurePersistence Clearance, Time To Max Concentration, Volume Of Distribution	No reported alias	4 identity 4 evidence
Reference Open	Persistence Half Life	No reported alias	2 identity 2 evidence
Reference Open	Distribution Volume Of Distribution	No reported alias	2 identity 2 evidence
Source record Open	Exposure Bioavailability	No reported alias SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFexact	1 identity 1 evidence
Reference Open	Exposure Time To Max Concentration	No reported alias	1 identity 1 evidence
Reference Open	Exposure Bioavailability	No reported alias	1 identity 1 evidence

Data access & reproducibility

Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.

Record scopePublic release

ATL peptide ID: ATLPC0009758
Identity type: canonical sequence
ADMET endpoints: 7
Evidence records: 18
Reference groups: 7
Release view: Public release

Data access

Structured peptide profile

JSON

Peptide-specific profile used by this page, including identity and evidence context.

Open JSON

Peptide catalogue

TSV

Complete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.

Download catalogue

Measurement catalogue

TSV

Complete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.

Download measurements

Programmatic access

The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.

Open endpoint

GET /api/v1/peptides/ATLPC0009758

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0009758' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'