Teriparatide
ATLPC0009758
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
- Length34 aa
- Monoisotopic mass
ATLPC0009758
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Is the peptide identity interpretable at sequence or structure-string level?
Are molecular graph, topology, or 3D coordinates available?
Can basic developability descriptors be computed?
Is this peptide linked to approved or named product context?
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
What safety, toxicity, or tolerability evidence is attached?
Can every measurement be reviewed in one cross-domain table?
Can the peptide identity be checked against reported names, sequence notation, and reference links?
Can this profile view be reproduced from structured records?
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Features are shown only when a reported notation or topology record supports them.
| Confidence |
|---|
| Match |
|---|
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | Observation In 5 patients with severe renal impairment (CrCl<30 mL/minute), the AUC and T 1/2 of teriparatide were increased by 73% and 77%, respectively. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Teriparatide· 12.3 Pharmacokinetics · teriparatide severe renal impairment auc increase t... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | Observation Maximum serum concentration of teriparatide was not increased. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · serum | Teriparatide· 12.3 Pharmacokinetics · teriparatide severe renal impairment cmax not incre... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 30 minutes 1800 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · serum | Route: subcutaneous · Teriparatide· 12.3 Pharmacokinetics · tmax peak serum about time · The peptide reaches pe... | Open |
| 2 | 0.5 hr 1800 seconds | Comparable | Tmax in human · human | time to max concentration · Tmax· Tmax in human · Exact ChEMBL pref name TERIPARATIDE · h... | Open |
| 3 | 0.25 hr 900 seconds | Comparable | Tmax in Sprague-Dawley rat at 5 ug/kg, sc · rat | Route: sc · time to max concentration · Tmax· Tmax in Sprague-Dawley rat at 5 ug/kg, sc · Exact ChEMB... | Open |
cell monolayer
barrier evidence
The identity reference does not expose a sequence string.
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.