Pramlintide
ATLPC0023266
- Measurements25
- Endpoints6
- Domains3/5
- Products1
- No matrix stability evidence
- 1 clearance measurement
- Product-level review pending
- No sequence liability cues
Open the matching evidence section below
Sequence & molecular identity
1 formsReviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.
This peptide currently has identity-level evidence, but no reviewed sequence, HELM, or SMILES representation for residue-level interpretation.
Structure & chemistry
Chemical representationnone
How the current release can interpret this identity chemically.
plain sequence-likeResidue string used for positional interpretation when available.
Not availablePolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
3D structure referencesnone attached
A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.
Covalent topology & modifications1 signal
| Feature | Positions | Interpretation | Link |
|---|---|---|---|
| Form-level topology | ATLPF0021981 | Disulfide-constrained form. Residue-level connection endpoints are shown separately when available. | Not linked |
Physicochemical profile
6 descriptorsComputed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.
These descriptors require a standard parent-residue sequence. The module remains visible so modified or unresolved identities are not forced into unreliable computed values.
Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.
Computed from the representative peptidoform's chemical structure. Rule-of-5 / beyond-Ro5 framing per Lipinski/Doak.
Computed logP — distinct from the measured logD endpoint.
3 Ro5 violations · MW 3,949.45 Da
Exposure / Absorption
22 recordsWhat evidence describes systemic exposure or absorption?
Distribution / Barrier
2 recordsWhat is known about distribution, binding, permeability, or barrier crossing?
Barrier and permeability assay context
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
cell monolayer
barrier evidence
Excretion / Persistence
1 recordsWhat evidence describes clearance or persistence?
Evidence interpretation
Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
Clearance1 record · 1 matched-context · 0 as reported · 0 context only · 0 review required
| # | Value | Analysis use | Assay / model | Result context | Reference |
|---|---|---|---|---|---|
| 1 | 2000 mL/h/kg | Eligible when experimental context matches | Manual extraction from peer-reviewed supplementary Table S1; apparent clearance CL/F derived from dose/AUC · human · plasma | Result: Reported point value · Molecular form: ATLPF0021981 · Route: subcutaneous · Source: Primary reference linked | Reference |
Evidence landscape
25 recordsCross-domain evidence distribution and measurement-level detail. 20 of 25 evidence records are included in the profile preview; the full index is loaded below.
Product context
1 productsProduct-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.
Summary1 linked product
- Linked products
- 1
- Label context
- None
- Clinical trials
- 25
- Safety label cues
- None
Linked products1 shown
Pramlintide
Identity & reference map
25 sourcesReference-level support for checking reported names, sequence notation, and peptide identity agreement.
Summary4 reference groups
- Identity type
- identity record
- Reported notation
- 1
- Reference groups
- 4
- Measurements
- 25
- ATL peptide ID
- ATLPC0023266
Identity concordance
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
No sequence representation
Reference map4 reference groups
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
Reference | Exposure Area Under Curve, Bioavailability, Max Concentration, Time To Max Concentration | No reported alias | 21 identity 16 evidence |
Source record | DistributionExposure Bioavailability, Plasma Protein Binding | No reported alias KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2different | 2 identity 2 evidence |
Reference | Exposure Bioavailability | No reported alias | 1 identity 1 evidence |
Reference | Persistence Clearance | No reported alias | 1 identity 1 evidence |
Data access & reproducibility
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Record scopePublic release
- ATL peptide ID
- ATLPC0023266
- Identity type
- identity record
- ADMET endpoints
- 6
- Evidence records
- 25
- Reference groups
- 4
- Release view
- Public release
Data access
Structured peptide profile
JSONPeptide-specific profile used by this page, including identity and evidence context.
Peptide catalogue
TSVComplete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.
Measurement catalogue
TSVComplete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.
Programmatic access
The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0023266' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'