Search results for "HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS"
Find peptides, products, and endpoints using the same public identifiers and summary language as the atlas list pages.
- Hits
- 16
- Filter
- peptide
Query
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Find peptides, products, and endpoints using the same public identifiers and summary language as the atlas list pages.
Search keeps entity types separate: a product record is not the same thing as a peptide identity, and one product can point to a selected peptide plus linked identity records. That is why a query such as HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS may show both product and peptide rows instead of one collapsed result.
Exact, prefix, contains, and separator-normalized matches are enabled. Broad typo-fuzzy matching is intentionally off so similar peptide names or identifiers are not merged by accident.
Sequence or backbone records that carry ADMET evidence.