Salmon Calcitonin

Salmon Calcitonin — ADMETatlas

Structure and chemistry interpretation

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure references8 references

Structure reference·

3D coordinates·Sequence matchexperimental

Sequence match·reference selected·identity 100.0%·confidence experimental

Link	Method

Covalent topology & modificationsnone

No explicit topology annotation

No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.

Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.

Computed descriptors

Core descriptors32 aa · pI 8.8 · GRAVY -0.54

Length: 32 aa
Monoisotopic mass: 3432.71 Da
Average mass: 3434.89 Da
Net charge at pH 7.4: 2.10
Estimated pI: 8.80
GRAVY: -0.538
KD-positive residues: 25.0%
Aromatic residues: 3.1%

Developability interpretation

Ionization context: pH 7.4 separated from pI
Hydrophobicity balance: Leans hydrophilic
Amphipathic moment (μH): 0.83
Computation boundary: Standard-sequence only

Charge & residue composition

pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2

4.97

pH 5

3.12

pH 6

2.77

pH 7.4

Hydropathy & amphipathic windows

Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window

4-10

LSTCVLG

GRAVY 1.771

Most hydrophilic window

20-26

QTYPRTN

GRAVY -2.257

26 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.

Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

Sequence-liability cues

Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Asn deamidation motif

NT · pos 26

Asn followed by small/polar residues is a known sequence context to review for deamidation susceptibility.

Oxidation-sensitive residues

C · pos 1, 7

Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.

Cys covalent complexity

C · pos 1, 7

Multiple cysteines can indicate disulfide or free-thiol interpretation requirements.

Alpha-helix amphipathic projection

Helical wheel · Edmundson projection

μ_H = 0.83100°/residue · 32 aa

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

5. Exposure / Absorption

What evidence describes systemic exposure or absorption?

Evidence summary

Measurements

Measurements, observations, and support attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Comparable measurements

Rows suitable for comparison only within matching endpoint and assay context.

Reported observations

Reviewed observations retained without being collapsed into comparable values.

Domain scope

Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.

Bioavailability AUC Cmax Tmax

Bioavailability, AUC, Cmax, and Tmax evidence.

Evidence interpretation

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Bioavailability6 measurements · 6 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	~ 66 %	Comparable	DailyMed SPL 12.3 Pharmacokinetics label extraction · human	Route: subcutaneous · Salmon Calcitonin· 12.3 Pharmacokinetics · calcitonin salmon bioavailability intramuscula...	Open
2	~ 71 %	Comparable	DailyMed SPL 12.3 Pharmacokinetics label extraction · human	Route: subcutaneous · Salmon Calcitonin· 12.3 Pharmacokinetics · calcitonin salmon bioavailability subcutaneous...	Open
3	3-5 %	Comparable	DailyMed SPL 12.3 Pharmacokinetics label extraction · human	Salmon Calcitonin· 12.3 Pharmacokinetics · bioavailability multiple percent values · 12.3...	Open
4	66 %	Comparable	PepTherDia curated product PK field	Route: IM · 14 · Salmon Calcitonin · exact product name match · exact or normalized match	Open
5	3-5 %	Comparable	PepTherDia curated product PK field	Route: NASAL · 14 · Salmon Calcitonin · exact product name match · exact or normalized match	Open
6	71 %	Comparable	PepTherDia curated product PK field	Route: SC · 14 · Salmon Calcitonin · exact product name match · exact or normalized match	Open

Interpretation: Exposure and absorption values should be compared only within matching route, dose, matrix, population, and unit context.

6. Distribution / Barrier

What is known about distribution, binding, permeability, or barrier crossing?

Evidence summary

Measurements

Measurements, observations, and support attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Comparable measurements

Rows suitable for comparison only within matching endpoint and assay context.

Reported observations

Reviewed observations retained without being collapsed into comparable values.

Domain scope

Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.

Plasma protein binding Vd

Distribution volume, plasma protein binding, permeability, and BBB penetration evidence.

Evidence interpretation

The same three research-facing layers are used across ADMETatlas.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Vd3 measurements · 3 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	0.15-0.3 L/kg	Comparable	Australian Medicine Finder PI 5.2 pharmacokinetics manual extraction · human · plasma	Not specified	Open
2	range 0.15-0.3 L/kg	Comparable	curated therapeutic product PK entry	Route: Official label support for calcitonin salmon apparent volume of distribution.	Open
3	0.15-0.3 L/kg	Comparable	DailyMed SPL 12.3 Pharmacokinetics label extraction · human	Salmon Calcitonin· 12.3 Pharmacokinetics · volume of distribution explicit unit range · T...	Open

Barrier and permeability assay context

PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.

PAMPA

artificial membrane

Caco-2

cell monolayer

MDCK

cell monolayer

RRCK

Interpretation: Distribution, protein binding, PAMPA, cell-monolayer, and BBB evidence are not interchangeable without matching assay/model context.

7. Excretion / Persistence

What evidence describes clearance or persistence?

Evidence summary

Measurements

Measurements, observations, and support attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Comparable measurements

Rows suitable for comparison only within matching endpoint and assay context.

Reported observations

Reviewed observations retained without being collapsed into comparable values.

Domain scope

Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.

Half Life Clearance

Clearance and half-life evidence.

Evidence interpretation

The same three research-facing layers are used across ADMETatlas.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Clearance1 measurement · 1 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	3.1 mL/min/kg	Comparable	Manual extraction from PubMed-indexed clinical PK abstract; constant-infusion metabolic clearance rate study · human · plasma	Route: intravenous infusion · Dose/window: 0.04 mg synthetic salmon calcitonin-(1-32) constant infusion; normal subjects;... · Time: equilibrium during 240 min infusion	Open

Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.

Evidence landscape and measurement index

Evidence landscape

A cross-domain view of where evidence is concentrated, which interpretation layers dominate, and how traceable the measurements are.

ADMET domain

Comparable

Reported

Contextual

Exposure / Absorption

22 measurements

Distribution / Barrier

5 measurements

Metabolic & Proteolytic Stability

0 measurements

Excretion / Persistence

3 measurements

Toxicity / Safety

0 measurements

Endpoint distribution

Top evidence-bearing endpoint questions.

Area Under Curve

Max Concentration

Bioavailability

Volume Of Distribution

Half Life

Plasma Protein Binding

Time To Max Concentration

Clearance

Assay context

Broad context buckets, useful before comparing values.

In vivo / route

Clinical / product

Matrix / stability

Traceability

Reference-link availability for measurement-level audit.

Linked reference

Not linked

All evidence index

Every measurement remains available for audit and drilldown. Counts describe evidence volume, not confidence.

DomainLayerReferenceSpeciesMatrixRoute

#	ADMET domain	Endpoint	Reported value	Evidence layer	Assay / model	Condition	Reference
1	Excretion / Persistence Persistence	Half Life	13.18 minutes 790.8 seconds	Comparable	LC-ESI-MS · rat · Rat kidney homogenates	Time: 5-360minutes · Dose/window: 10 μM · Protease: Rat kidney homogenates proteases · in vitro	Open
2	Excretion / Persistence Persistence	Half Life	43.07 minutes 2,584.2 seconds	Comparable	LC-ESI-MS · rat · Rat Liver homogenates	Time: 5-360minutes · Dose/window: 10 μM · Protease: Rat kidney homogenates proteases · in vitro	Open
3	Distribution / Barrier Distribution	Plasma Protein Binding	30-40 %	Comparable	Australian Medicine Finder PI 5.2 pharmacokinetics manual extraction · human · plasma	Miacalcic solution for injection product information reports calcitonin salmon pharmacokinetic distribution parameters.	Open
4	Distribution / Barrier Distribution	Volume Of Distribution	0.15-0.3 L/kg	Comparable	Australian Medicine Finder PI 5.2 pharmacokinetics manual extraction · human · plasma	Miacalcic solution for injection product information reports calcitonin salmon pharmacokinetic distribution parameters.	Open
5	Distribution / Barrier Distribution	Volume Of Distribution	range 0.15-0.3 L/kg	Comparable	curated therapeutic product PK entry	Route: Official label support for calcitonin salmon apparent volume of distribution. · Official label support for calcitonin salmon apparent volume of distribution.	Open
6	Distribution / Barrier Distribution	Plasma Protein Binding	30-40 %	Comparable	PepTherDia curated product PK field · plasma protein	Route: SC, IM, NASAL	Open
7	Exposure / Absorption Exposure	Bioavailability	71 %	Comparable	PepTherDia curated product PK field	Route: SC	Open
8	Exposure / Absorption Exposure	Bioavailability	66 %	Comparable	PepTherDia curated product PK field	Route: IM	Open
9	Exposure / Absorption Exposure	Bioavailability	3-5 %	Comparable	PepTherDia curated product PK field	Route: NASAL	Open
10	Exposure / Absorption Exposure	Area Under Curve	52.2 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 ·...	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling · Human exploratory crossover PK study. Oral SMC021 was an oral salmon-calcitonin plus 5-CNAC formulation · Miacalcic nasal...	Open

1–10 / 30

Identity & reference map

Summary8 reference groups

Identity type: canonical sequence
Reported notation: 1
Reference groups: 8
Measurements: 30
ATL peptide ID: ATLPC0001542

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

3 / 3

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 3

Different notation

Reported notation does not resolve to the current display sequence.

0 / 3

Reference map8 of 8 shown

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
DOI 10.1186/1472-6904-8-5 Open	Exposure Area Under Curve, Max Concentration	No reported alias	0 identity 14 evidence
PubMed 18972837 Open	Persistence Half Life	No reported alias CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPexact	2 identity 2 evidence
Reference link Open	DistributionExposure Bioavailability, Plasma Protein Binding	No reported alias	0 identity 4 evidence
Reference link Open	DistributionExposure Bioavailability, Time To Max Concentration, Volume Of Distribution	No reported alias	0 identity 4 evidence
Reference link Open	Distribution Plasma Protein Binding, Volume Of Distribution	No reported alias CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPexact	1 identity 2 evidence
Reference link Open	Exposure Bioavailability, Time To Max Concentration	No reported alias	0 identity 2 evidence
Reference link Open	Distribution Volume Of Distribution	No reported alias	0 identity 1 evidence
PubMed 571211 Open	Persistence Clearance	No reported alias	0 identity 1 evidence

Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.

Data access & reproducibility

Record scopePublic release

ATL peptide ID: ATLPC0001542
Identity type: canonical sequence
ADMET endpoints: 8
Measurements: 30
Reference groups: 8
Release view: Public release

Analysis-ready files

Peptide record

TSV

Identity, sequence, profile-level fields, and current release view metadata.

Download record

Programmatic access

The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.

Open endpoint

GET /api/v1/peptides/ATLPC0001542

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0001542' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'

Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.

AUC7 measurements · 7 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	16.4 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: intranasal · Dose/window: 0-4 h post-dose serial plasma sampling	Open
2	52.2 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
3	68.9 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
4	74.4 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
5	27.4 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
6	32.9 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
7	33.6 pg*h/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open

Cmax7 measurements · 7 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	11.4 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: intranasal · Dose/window: 0-4 h post-dose serial plasma sampling	Open
2	103 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
3	125 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
4	145 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
5	52 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
6	56 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open
7	49 pg/mL	Comparable	Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma	Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling	Open

Tmax2 measurements · 2 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	~ 23 minutes ~ 1380 seconds	Comparable	DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma	Route: subcutaneous · Salmon Calcitonin· 12.3 Pharmacokinetics · tmax peak plasma levels reached approximately...	Open
2	~ 13 minutes ~ 780 seconds	Comparable	DailyMed SPL 12.3 Pharmacokinetics label extraction · human	Salmon Calcitonin· 12.3 Pharmacokinetics · tmax of value · Calcitonin salmon nasal spray...	Open

Plasma protein binding2 measurements · 2 comparable · 0 reported · 0 contextual

#	Value	Evidence layer	Assay / model	Condition	Reference
1	30-40 %	Comparable	Australian Medicine Finder PI 5.2 pharmacokinetics manual extraction · human · plasma	Not specified	Open
2	30-40 %	Comparable	PepTherDia curated product PK field · plasma protein	Route: SC, IM, NASAL · 14 · Salmon Calcitonin · exact product name match · exact or normalized match	Open

#	Value	Evidence layer	Assay / model	Condition	Reference
1	13.18 minutes 790.8 seconds	Comparable	LC-ESI-MS · rat · Rat kidney homogenates	Dose/window: 10 μM · Time: 5-360minutes · Rat kidney homogenates proteases · in vitro	Open
2	43.07 minutes 2584.2 seconds	Comparable	LC-ESI-MS · rat · Rat Liver homogenates	Dose/window: 10 μM · Time: 5-360minutes · Rat kidney homogenates proteases · in vitro	Open

Salmon Calcitonin

Peptide developability profile

1. Sequence & peptidoform

Sequence interpretation

2. Structure & chemistry

Structure and chemistry interpretation

3. Physicochemical profile

Computed descriptors

Computed developability descriptors

4. Product context

Translational product context

5. Exposure / Absorption

Evidence summary

6. Distribution / Barrier

Evidence summary

7. Excretion / Persistence

Evidence summary

8. Evidence landscape

Evidence landscape and measurement index

9. Identity & reference map

Identity & reference map

10. Data access & reproducibility

Data access & reproducibility

Peptide record

Evidence table

Structured record

Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity