Peptide·plain sequence-like
Salmon Calcitonin
ATLPC0001542
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Routes
- Length32 aa
ATLPC0001542
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
How stable is the peptide in biological matrices or protease systems?
What safety, toxicity, or tolerability evidence is attached?
Normalized for positional visualization, not a replacement for the reported modified notation.
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Original notation retained for interpretation and comparison.
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
| Link | Method |
|---|
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Modeled net charge across common formulation and assay pH checkpoints.
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
A280 (1 g/L) ≈ 0.43 · 1,615 M⁻¹·cm⁻¹ with 1 disulfide
Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Bioavailability, AUC, Cmax, and Tmax evidence.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | ~ 66 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Salmon Calcitonin· 12.3 Pharmacokinetics · calcitonin salmon bioavailability intramuscula... | Open |
| 2 | ~ 71 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Salmon Calcitonin· 12.3 Pharmacokinetics · calcitonin salmon bioavailability subcutaneous... | Open |
| 3 | 3-5 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Salmon Calcitonin· 12.3 Pharmacokinetics · bioavailability multiple percent values · 12.3... | Open |
| 4 | 66 % | Comparable | PepTherDia curated product PK field | Route: IM · 14 · Salmon Calcitonin · exact product name match · exact or normalized match | Open |
| 5 | 3-5 % | Comparable | PepTherDia curated product PK field | Route: NASAL · 14 · Salmon Calcitonin · exact product name match · exact or normalized match | Open |
| 6 | 71 % | Comparable | PepTherDia curated product PK field | Route: SC · 14 · Salmon Calcitonin · exact product name match · exact or normalized match | Open |
Interpretation: Exposure and absorption values should be compared only within matching route, dose, matrix, population, and unit context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Distribution volume, plasma protein binding, permeability, and BBB penetration evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.15-0.3 L/kg | Comparable | Australian Medicine Finder PI 5.2 pharmacokinetics manual extraction · human · plasma | Not specified | Open |
| 2 | range 0.15-0.3 L/kg | Comparable | curated therapeutic product PK entry | Route: Official label support for calcitonin salmon apparent volume of distribution. | Open |
| 3 | 0.15-0.3 L/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Salmon Calcitonin· 12.3 Pharmacokinetics · volume of distribution explicit unit range · T... | Open |
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
Interpretation: Distribution, protein binding, PAMPA, cell-monolayer, and BBB evidence are not interchangeable without matching assay/model context.
Reviewed observations retained without being collapsed into comparable values.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 3.1 mL/min/kg | Comparable | Manual extraction from PubMed-indexed clinical PK abstract; constant-infusion metabolic clearance rate study · human · plasma | Route: intravenous infusion · Dose/window: 0.04 mg synthetic salmon calcitonin-(1-32) constant infusion; normal subjects;... · Time: equilibrium during 240 min infusion | Open |
Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
DOI 10.1186/1472-6904-8-5 | Exposure Area Under Curve, Max Concentration | No reported alias | 0 identity 14 evidence |
PubMed 18972837 | Persistence Half Life | No reported alias CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPexact | 2 identity 2 evidence |
Reference link | DistributionExposure Bioavailability, Plasma Protein Binding | No reported alias | 0 identity 4 evidence |
Reference link | DistributionExposure Bioavailability, Time To Max Concentration, Volume Of Distribution | No reported alias | 0 identity 4 evidence |
Reference link | Distribution Plasma Protein Binding, Volume Of Distribution | No reported alias CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPexact | 1 identity 2 evidence |
Reference link | Exposure Bioavailability, Time To Max Concentration | No reported alias | 0 identity 2 evidence |
Reference link | Distribution Volume Of Distribution | No reported alias | 0 identity 1 evidence |
PubMed 571211 | Persistence Clearance | No reported alias | 0 identity 1 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0001542' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
Features are shown only when a reported notation or topology record supports them.
| Match |
|---|
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match |
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 16.4 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: intranasal · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 2 | 52.2 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 3 | 68.9 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 4 | 74.4 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 5 | 27.4 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 6 | 32.9 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 7 | 33.6 pg*h/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 11.4 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: intranasal · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 2 | 103 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 3 | 125 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 4 | 145 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 5 | 52 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 6 | 56 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| 7 | 49 pg/mL | Comparable | Chemiluminescence two-site immunometric plasma sCT assay; trapezoidal AUC calculation; manual extraction from Table 3 · human · plasma | Route: oral · Dose/window: 0-4 h post-dose serial plasma sampling | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | ~ 23 minutes ~ 1380 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Salmon Calcitonin· 12.3 Pharmacokinetics · tmax peak plasma levels reached approximately... | Open |
| 2 | ~ 13 minutes ~ 780 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Salmon Calcitonin· 12.3 Pharmacokinetics · tmax of value · Calcitonin salmon nasal spray... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 30-40 % | Comparable | Australian Medicine Finder PI 5.2 pharmacokinetics manual extraction · human · plasma | Not specified | Open |
| 2 | 30-40 % | Comparable | PepTherDia curated product PK field · plasma protein | Route: SC, IM, NASAL · 14 · Salmon Calcitonin · exact product name match · exact or normalized match | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 13.18 minutes 790.8 seconds | Comparable | LC-ESI-MS · rat · Rat kidney homogenates | Dose/window: 10 μM · Time: 5-360minutes · Rat kidney homogenates proteases · in vitro | Open |
| 2 | 43.07 minutes 2584.2 seconds | Comparable | LC-ESI-MS · rat · Rat Liver homogenates | Dose/window: 10 μM · Time: 5-360minutes · Rat kidney homogenates proteases · in vitro | Open |
The identity reference does not expose a sequence string.
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
| 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |