Peptide·plain sequence-like
Glucagon
ATLPC0002714
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Routes
- Length29 aa
- Monoisotopic mass
ATLPC0002714
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
What safety, toxicity, or tolerability evidence is attached?
Normalized for positional visualization, not a replacement for the reported modified notation.
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Original notation retained for interpretation and comparison.
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
| Link |
|---|
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Modeled net charge across common formulation and assay pH checkpoints.
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
Above 2.48 — elevated potential protein-binding.
A280 (1 g/L) ≈ 2.44
Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Bioavailability, AUC, Cmax, and Tmax evidence.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 16 % | Comparable | Population PK/PD model manual extraction from peer-reviewed article · human · serum | Route: intranasal | Open |
Interpretation: Exposure and absorption values should be compared only within matching route, dose, matrix, population, and unit context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Distribution volume, plasma protein binding, permeability, and BBB penetration evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.25 L/kg | Comparable | curated therapeutic product PK entry | Route: Official label support for glucagon mean volume of distribution. | Open |
| 2 | ~ 885 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Glucagon· 12.3 Pharmacokinetics · volume of distribution single · Distribution The appare... | Open |
| 3 | 137-2425 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · volume of distribution hyphen range · Time After Subcut... | Open |
| 4 | 0.25 L/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · serum | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · volume of distribution single · Figure 2 Mean (SE) seru... | Open |
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
Interpretation: Distribution, protein binding, PAMPA, cell-monolayer, and BBB evidence are not interchangeable without matching assay/model context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Serum/plasma stability and protease stability evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | < 10 minutes < 600 seconds | Comparable | ELISA · human · Human serum | Human blood proteases · in vitro | Open |
| 2 | 9 hours 32400 seconds | Comparable | ELISA · monkey · Monkey plasma (Subcutaneous) | Dose/window: 12 nmol/kg · Monkey blood proteases · in vivo | Open |
| 3 | 3.2 Minutes 192 seconds | Comparable | RIA · rat · Surgical rats plasma (Wistar rat) | Route: IV · Dose/window: 30 nmol/ml · Time: A total of 19 other samples were taken at the following time points from the beginning of peptide infusion: 0... · Surgical rats plasma protease (Wistar Rat) · In Vivo | Open |
Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.
Reviewed observations retained without being collapsed into comparable values.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 13.5 mL/min/kg | Comparable | curated therapeutic product PK entry | Route: Official label support for glucagon mean clearance. | Open |
| 2 | 13.5 mL/min/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Glucagon· 12.3 Pharmacokinetics · clearance single · Elimination The mean clearance was 1... | Open |
Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
Reference link | DistributionExposure Max Concentration, Plasma Protein Binding, Time To Max Concentration | No reported alias | 0 identity 7 evidence |
PubMed 20418955 | PersistenceStability Half Life, Serum Plasma Stability | No reported alias HSQGTFTSDYSKYLDSRRAQDFVQWLMNTexact | 3 identity 3 evidence |
PubMed 33135460 | Persistence Half Life | No reported alias HSQGTFTSDYSKYLDSRRAQDFVQWLMNTexact | 3 identity 3 evidence |
Reference link | DistributionExposurePersistence Clearance, Max Concentration, Time To Max Concentration, Volume Of Distribution | No reported alias | 0 identity 6 evidence |
Reference link | DistributionExposure Area Under Curve, Max Concentration, Time To Max Concentration, Volume Of Distribution | No reported alias | 0 identity 4 evidence |
Reference link | DistributionPersistence Clearance, Volume Of Distribution | No reported alias HSQGTFTSDYSKYLDSRRAQDFVQWLMNTexact | 1 identity 2 evidence |
Reference link | DistributionExposure Max Concentration, Time To Max Concentration, Volume Of Distribution | No reported alias | 0 identity 3 evidence |
PubMed 27689406 | Stability Serum Plasma Stability | No reported alias HSQGTFTSDYSKYLDSRRAQDFVQWLMNTexact | 1 identity 1 evidence |
PubMed 38736200 | Exposure Bioavailability | No reported alias | 0 identity 1 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0002714' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
Features are shown only when a reported notation or topology record supports them.
| Method |
|---|
| Confidence |
|---|
| Match |
|---|
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match |
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 3454.6 pg*min/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · auc of value · 12.3 Pharmacokinetics Absorption Subcuta... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 6130 pg/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Glucagon· 12.3 Pharmacokinetics · cmax single peak plasma level at around time · 12.3 Pha... | Open |
| 2 | 6.9 ng/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · glucagon dual route cmax intramuscular · 12.3 Pharmacok... | Open |
| 3 | 7.9 ng/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · glucagon dual route cmax subcutaneous · 12.3 Pharmacoki... | Open |
| 4 | 2481.3 pg/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · cmax of value · 12.3 Pharmacokinetics Absorption Subcut... | Open |
| 5 | 6.9 ng/mL | Comparable | PepTherDia curated product PK field | Route: IM · 18 · Glucagon · exact product name match · exact or normalized match | Open |
| 6 | 7.9 ng/mL | Comparable | PepTherDia curated product PK field | Route: IV · 18 · Glucagon · exact product name match · exact or normalized match | Open |
| 7 | 6130 pg/mL | Comparable | PepTherDia curated product PK field | Route: NASAL · 18 · Glucagon · exact product name match · exact or normalized match | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | ~ 15 minutes ~ 900 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Glucagon· 12.3 Pharmacokinetics · tmax single peak plasma level at around time · 12.3 Pha... | Open |
| 2 | ~ 13 minutes ~ 780 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · glucagon dual route tmax intramuscular · 12.3 Pharmacok... | Open |
| 3 | ~ 20 minutes ~ 1200 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · glucagon dual route tmax subcutaneous · 12.3 Pharmacoki... | Open |
| 4 | 50 minutes 3000 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Glucagon· 12.3 Pharmacokinetics · tmax of value · 12.3 Pharmacokinetics Absorption Subcut... | Open |
| 5 | 13 minutes 780 seconds | Comparable | PepTherDia curated product PK field | Route: IM · 18 · Glucagon · exact product name match · exact or normalized match | Open |
| 6 | 20 minutes 1200 seconds | Comparable | PepTherDia curated product PK field | Route: IV · 18 · Glucagon · exact product name match · exact or normalized match | Open |
| 7 | 15 minutes 900 seconds | Comparable | PepTherDia curated product PK field | Route: NASAL · 18 · Glucagon · exact product name match · exact or normalized match | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | Observation No binding | Reported | PepTherDia curated product PK field · plasma protein | Route: IV, IM, SC, NASAL · 18 · Glucagon · exact product name match · exact or normalized match | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | < 10 minutes < 600 seconds | Comparable | natural | in vivo | Open |
| 2 | 3.96 ± 1.12 Minutes 237.6 seconds | Comparable | Two site ELISA · human · Human blood sample (All) | Route: IV · Dose/window: 0.65 ng/kg/min from 1100 (120 min) till the end of the study at 1400 (300 min) · Time: 1 day · Human blood protease (All) · In Vivo | Open |
| 3 | 3.94 ± 1.10 Minutes 236.4 seconds | Comparable | Two site ELISA · human · Human female blood sample | Route: IV · Dose/window: 0.65 ng/kg/min from 1100 (120 min) till the end of the study at 1400 (300 min) · Time: 1 day · Human female blood protease · In Vivo | Open |
| 4 | 4.01 ± 1.19 Minutes 240.6 seconds | Comparable | Two site ELISA · human · Human male blood sample | Route: IV · Dose/window: 0.65 ng/kg/min from 1100 (120 min) till the end of the study at 1400 (300 min) · Time: 1 day · Human male blood protease · In Vivo | Open |
The identity reference does not expose a sequence string.
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
| 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Experimental structure match | experimental | 29 aa |