Peptide·plain sequence-like
Enfuvirtide
ATLPC0006962
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Routes
- Length36 aa
- Monoisotopic mass
ATLPC0006962
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
What safety, toxicity, or tolerability evidence is attached?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
Normalized for positional visualization, not a replacement for the reported modified notation.
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Original notation retained for interpretation and comparison.
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
| Link |
|---|
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Modeled net charge across common formulation and assay pH checkpoints.
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
A280 (1 g/L) ≈ 4.04
Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Bioavailability, AUC, Cmax, and Tmax evidence.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 84.3 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: intravenous · Enfuvirtide· 12.3 Pharmacokinetics · bioavailability single percent · The absolute bioava... | Open |
| 2 | 84.3 % | Comparable | PepTherDia curated product PK field | Route: SC · 22 · Enfuvirtide · exact product name match · exact or normalized match | Open |
Interpretation: Exposure and absorption values should be compared only within matching route, dose, matrix, population, and unit context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Distribution volume, plasma protein binding, permeability, and BBB penetration evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 5.5 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: intravenous · Enfuvirtide· 12.3 Pharmacokinetics · enfuvirtide iv steady state volume of distribution ·... | Open |
| 2 | 0.44 L/kg | Comparable | Volume of distribution in rat at 4 mg/kg, iv administered as single dose · rat | Route: iv · volume of distribution · Vd· Volume of distribution in rat at 4 mg/kg, iv administered as... | Open |
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
Interpretation: Distribution, protein binding, PAMPA, cell-monolayer, and BBB evidence are not interchangeable without matching assay/model context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Serum/plasma stability and protease stability evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 57960.00000000001 seconds | Comparable | HPLC · rat · SD rats plasma | Dose/window: 1.7 μmol/kg · SD rats plasma protease · In Vivo | Open |
| 2 | 5400 seconds | Comparable | HPLC · rat · SD rats plasma | Dose/window: 1.7 μmol/kg · SD rats plasma protease · In Vivo | Open |
| 3 | 1.5 hours 5400 seconds | Comparable | HPLC · rat · Sprague-Dawey (SD) rats Plasma | Dose/window: 1.7μM/Kg · Time: 0.5-24 hours · Rat plasma proteases · in vivo | Open |
| 4 | 8.8 hours 31680.000000000004 seconds | Comparable | RP-HPLC and ESI-MS · monkey · Male cynomolgus monkey blood plasma (Intravenous) | Dose/window: ~1 -2mg/kg · Monkey blood proteases · in vivo | Open |
| 5 | 8.8 hours 31680.000000000004 seconds | Comparable | RP-HPLC and ESI-MS · monkey · Male cynomolgus monkey blood plasma (Intravenous) | Dose/window: ~1 -2mg/kg · Monkey blood proteases · in vivo | Open |
| 6 | 8.8 hours 31680.000000000004 seconds | Comparable | RP-HPLC and ESI-MS · monkey · Male cynomolgus monkey blood plasma (Intravenous) | Dose/window: ~1 -2mg/kg · Monkey blood proteases · in vivo | Open |
| 7 | 8.8 hours 31680.000000000004 seconds | Comparable | RP-HPLC and ESI-MS · monkey · Male cynomolgus monkey blood plasma (Intravenous) | Dose/window: ~1 -2mg/kg · Monkey blood proteases · in vivo | Open |
| 8 | 8.8 hours 31680.000000000004 seconds | Comparable | RP-HPLC and ESI-MS · monkey · Male cynomolgus monkey blood plasma (Intravenous) | Dose/window: ~1 -2mg/kg · Monkey blood proteases · in vivo | Open |
| 9 | 1.22 ± 0.2 Hours 4392 seconds | Comparable | Sandwich ELISA · rat · Rats serum | Route: IV · Dose/window: 1.26 mg/kg · Time: Blood samples were collected from the orbital sinus at 0, 0.5, 1.5, 3, 6, 9, 12, 24, 48, 72, 96 and 120 h aft... · Rats serum protease · In Vivo | Open |
Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.
Reviewed observations retained without being collapsed into comparable values.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.0248 L/h/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Enfuvirtide· 12.3 Pharmacokinetics · enfuvirtide apparent clearance single dose sc · Foll... | Open |
| 2 | 0.0306 L/h/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Enfuvirtide· 12.3 Pharmacokinetics · enfuvirtide apparent clearance steady state sc twice... | Open |
Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Hemolysis, cytotoxicity, clinical adverse-event context, and nonclinical safety context.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
Interpretation: Clinical and nonclinical context can guide interpretation, but it is not incidence, causality, or a comparable endpoint measurement.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
PubMed 17640899 | Stability Serum Plasma Stability | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 5 identity 5 evidence |
PubMed 15656696 | Persistence Half Life | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 4 identity 4 evidence |
Reference link | DistributionExposurePersistence Bioavailability, Clearance, Plasma Protein Binding, Time To Max Concentration +1 more | No reported alias | 0 identity 7 evidence |
PubMed 27240277 | Stability Serum Plasma Stability | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 2 identity 2 evidence |
PubMed 30716118 | Safety Cytotoxicity Percent Observation | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 2 identity 2 evidence |
Reference link | DistributionExposure Bioavailability, Plasma Protein Binding | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 1 identity 2 evidence |
PubMed 25156906 | DistributionExposure Area Under Curve, Max Concentration, Volume Of Distribution | No reported alias | 0 identity 3 evidence |
PubMed 35455421 | Stability Serum Plasma Stability | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 1 identity 1 evidence |
PubMed 19805567 | Persistence Half Life | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 1 identity 1 evidence |
PubMed 25594223 | Stability Serum Plasma Stability | No reported alias YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFexact | 1 identity 1 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0006962' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
Features are shown only when a reported notation or topology record supports them.
| Method |
|---|
| Confidence |
|---|
| Match |
|---|
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match |
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 26900 ng*h/mL | Comparable | AUC (0 to t) in rat at 4 mg/kg, iv administered as single dose · rat | Route: iv · area under curve · AUC· AUC (0 to t) in rat at 4 mg/kg, iv administered as single dose ·... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 5676834.51 nM | Comparable | Cmax in rat at 4 mg/kg, iv administered as single dose · rat | Route: iv · max concentration · Cmax· Cmax in rat at 4 mg/kg, iv administered as single dose · Exact... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 8 hours 28800 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Enfuvirtide· 12.3 Pharmacokinetics · tmax median tmax was · Absorption Following a 90-mg... | Open |
| 2 | 4 hours 14400 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Enfuvirtide· 12.3 Pharmacokinetics · tmax median tmax was · Following 90-mg twice daily d... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | ~ 92 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Enfuvirtide· 12.3 Pharmacokinetics · plasma binding percent bound to plasma matrix · Enfu... | Open |
| 2 | 92 % | Comparable | PepTherDia curated product PK field · plasma protein | Route: SC · 22 · Enfuvirtide · exact product name match · exact or normalized match | Open |
| 3 | 81.3 % | Comparable | Plasma protein binding in human by LC-MS/MS analysis · human · plasma | plasma protein binding · PPB· Plasma protein binding in human by LC-MS/MS analysis · Exac... | Open |
| 4 | 95.9 % | Comparable | Plasma protein binding in rat by LC-MS/MS analysis · rat · plasma | plasma protein binding · PPB· Plasma protein binding in rat by LC-MS/MS analysis · Exact... | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 2.8 hours 10080 seconds | Comparable | LC-MS/MS · rat · Female Wistar rats | Dose/window: dose, 4 mg/kg of body weight · Time: 5, 15, and 30 min and 1, 2, 4, 8, 24, and 48 h after drug injection · Wistar rats blood protease · in vivo | Open |
| 2 | Observation 3.16(t1/2β) | Reported | liquid chromatography-tandem mass spectrometry method · human · Intravenous injection in 12 HIV patients,blood samples | Dose/window: 90mg · Human blood proteases · in vivo | Open |
| 3 | Observation 4.35(t1/2β) | Reported | liquid chromatography-tandem mass spectrometry method · human · Subcutaneous injection in 12 HIV patients,blood samples | Dose/window: 180mg · Human blood proteases · in vivo | Open |
| 4 | Observation 3.46(t1/2β) | Reported | liquid chromatography-tandem mass spectrometry method · human · Subcutaneous injection in 12 HIV patients,blood samples | Dose/window: 45mg · Human blood proteases · in vivo | Open |
| 5 | Observation 3.8(t1/2β) | Reported | liquid chromatography-tandem mass spectrometry method · human · Subcutaneous injection in 12 HIV patients,blood samples | Dose/window: 90mg · Human blood proteases · in vivo | Open |
The identity reference does not expose a sequence string.
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
| 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 97.2% identity |
| Open | Homology model | predicted | 36 aa |