Mecasermin
ATLPC0011025
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Length70 aa
- Monoisotopic mass
ATLPC0011025
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Is the peptide identity interpretable at sequence or structure-string level?
Are molecular graph, topology, or 3D coordinates available?
Can basic developability descriptors be computed?
Is this peptide linked to approved or named product context?
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
What safety, toxicity, or tolerability evidence is attached?
Can every measurement be reviewed in one cross-domain table?
Can the peptide identity be checked against reported names, sequence notation, and reference links?
Can this profile view be reproduced from structured records?
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Features are shown only when a reported notation or topology record supports them.
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 2932 ng*h/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Mecasermin· 12.3 Pharmacokinetics · mecasermin table1 auc 0 8 mean · Table 1. Summary of... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 234 ng/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Mecasermin· 12.3 Pharmacokinetics · mecasermin table1 cmax mean · Table 1. Summary of INC... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 2 hr 7200 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Route: subcutaneous · Mecasermin· 12.3 Pharmacokinetics · mecasermin table1 tmax mean · Table 1. Summary of INC... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | > 80 % | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · blood | Mecasermin· 12.3 Pharmacokinetics · mecasermin blood igf binding protein bound percent ·... | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 33 minutes 1980 seconds | Comparable | Antibody assay · rat · Rat Colon luminal flushing | Dose/window: 8.6ng · Time: 5, 10, 20, 30 or 60 min · Rat Colon luminal flushing proteases · in vitro | Open |
| 2 | 2 minutes 120 seconds | Comparable | Antibody assay · rat · Rat Duodenum luminal flushing | Dose/window: 8.6ng · Time: 2-5, 5, 7-5, 10 or 20min · Rat Duodenum luminal flushing proteases · in vitro | Open |
| 3 | 2 minutes 120 seconds | Comparable | Antibody assay · rat · Rat Ileum luminal flushing | Dose/window: 8.6ng · Time: 2-5, 5, 7-5, 10 or 20min · Rat Ileum luminal flushing proteases · in vitro | Open |
| 4 | 5 minutes 300 seconds | Comparable | Antibody assay · rat · Rat Stomach luminal flushing | Dose/window: 8.6ng · Time: 5, 10, 20, 30 or 60 min · Rat Stomach luminal flushing proteases · in vitro | Open |
| 5 | 16 minutes 960 seconds | Comparable | Receptor-precipitable radioactivity · rat · Rat Colon luminal flushing | Dose/window: 8.6ng · Time: 5, 10, 20, 30 or 60 min · Rat Colon luminal flushing proteases · in vitro | Open |
| 6 | 2 minutes 120 seconds | Comparable | Receptor-precipitable radioactivity · rat · Rat Duodenum luminal flushing | Dose/window: 8.6ng · Time: 2-5, 5, 7-5, 10 or 20min · Rat Duodenum luminal flushing proteases · in vitro | Open |
| 7 | 2 minutes 120 seconds | Comparable | Receptor-precipitable radioactivity · rat · Rat Ileum luminal flushing | Dose/window: 8.6ng · Time: 2-5, 5, 7-5, 10 or 20min · Rat Ileum luminal flushing proteases · in vitro | Open |
| 8 | 2.5 minutes 150 seconds | Comparable | Receptor-precipitable radioactivity · rat · Rat Stomach luminal flushing | Dose/window: 8.6ng · Time: 5, 10, 20, 30 or 60 min · Rat Stomach luminal flushing proteases · in vitro | Open |
| 9 | 38 minutes 2280 seconds | Comparable | TCA precipitation · rat · Rat Colon luminal flushing | Dose/window: 8.6ng · Time: 5, 10, 20, 30 or 60 min · Rat Colon luminal flushing proteases · in vitro | Open |
| 10 | 2 minutes 120 seconds | Comparable | TCA precipitation · rat · Rat Duodenum luminal flushing | Dose/window: 8.6ng · Time: 2-5, 5, 7-5, 10 or 20min · Rat Duodenum luminal flushing proteases · in vitro | Open |
The identity reference does not expose a sequence string.
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.