Peptide·modified or textual
Semaglutide
ATLPC0011948
H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Routes
- Length33 aa
ATLPC0011948
H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
Can basic developability descriptors be computed?
What safety, toxicity, or tolerability evidence is attached?
Normalized for positional visualization, not a replacement for the reported modified notation.
HAIXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Original notation retained for interpretation and comparison.
H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
HAIXEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
| Link | Method |
|---|
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Bioavailability, AUC, Cmax, and Tmax evidence.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 94 % | Comparable | Bioavailability in Gottingen mini pig at 2 nmol/kg, sc · porcine | Route: sc · bioavailability · F· Bioavailability in Gottingen mini pig at 2 nmol/kg, sc · Exact ChEMB... | Open |
| 2 | 1-2 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: oral · Semaglutide· 12.3 Pharmacokinetics · bioavailability percent range direct · Absolute bioa... | Open |
| 3 | 1-2 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: oral · Semaglutide· 12.3 Pharmacokinetics · semaglutide ozempic oral tablet bioavailability rang... | Open |
| 4 | 0.4-1 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: oral · Semaglutide· 12.3 Pharmacokinetics · semaglutide rybelsus oral bioavailability range · Se... | Open |
| 5 | 89 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Semaglutide· 12.3 Pharmacokinetics · bioavailability single percent · 12.3 Pharmacokineti... | Open |
| 6 | 89 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · bioavailability single percent · 12.3 Pharmacokineti... | Open |
| 7 | 89 % | Comparable | PepTherDia curated product PK field | Route: SC, ORAL · 63 · Semaglutide · exact product name match · field mismatch | Open |
Interpretation: Exposure and absorption values should be compared only within matching route, dose, matrix, population, and unit context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Distribution volume, plasma protein binding, permeability, and BBB penetration evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.1019 L/kg | Comparable | Apparent volume of distribution in Gottingen mini pig at 2 nmol/kg, iv · porcine | Route: iv · volume of distribution · Vd· Apparent volume of distribution in Gottingen mini pig at 2 n... | Open |
| 2 | 12.5 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Semaglutide· 12.3 Pharmacokinetics · volume of distribution approximately single · Distri... | Open |
| 3 | ~ 12.5 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Semaglutide· 12.3 Pharmacokinetics · volume of distribution single · Distribution The mea... | Open |
| 4 | ~ 8 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · volume of distribution single · Distribution Semaglu... | Open |
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
Interpretation: Distribution, protein binding, PAMPA, cell-monolayer, and BBB evidence are not interchangeable without matching assay/model context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Serum/plasma stability and protease stability evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 158 Hours 568800 seconds | Comparable | LC-MS · human · Human plasma (Healthy subjects) | Route: Oral dose · Time: Blood samples for PK assessment were obtained during the first 9 days of dosing (7–45 samples per subject) an... · Human plasma protease · In Vivo | Open |
| 2 | 146 Hours 525600 seconds | Comparable | LC-MS · human · Human plasma (Subjects with T2D) | Route: Oral dose · Time: Blood samples for PK assessment were obtained during the first 9 days of dosing (7–45 samples per subject) an... · Human plasma protease · In Vivo | Open |
| 3 | 248400 seconds | Comparable | LC-MS · porcine · Minipigs plasma | Dose/window: 10 nmol/kg · Time: Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks) · Minipigs plasma protease · In Vivo | Not linked |
| 4 | 180.5 Hours 649800 seconds | Comparable | LC-MS/MS · human · Human plasma | Route: SC · Dose/window: 1 mg/ml · Time: Blood sample were collected at predose, 8, 16, 24,32,40,48,56,64,72,96,120,144,168,240,336,504,672 and 840 ho... · Human plasma protease · In Vivo | Open |
| 5 | 168.3 Hours 605880 seconds | Comparable | LC-MS/MS · human · Human plasma | Route: SC · Dose/window: 1 mg/ml · Time: Blood sample were collected at predose, 8, 16, 24,32,40,48,56,64,72,96,120,144,168,240,336,504,672 and 840 ho... · Human plasma protease · In Vivo | Open |
| 6 | 201.2 Hours 724320 seconds | Comparable | LC-MS/MS · human · Human plasma | Route: SC · Dose/window: 1 mg/ml · Time: Blood sample were collected at predose, 8, 16, 24,32,40,48,56,64,72,96,120,144,168,240,336,504,672 and 840 ho... · Human plasma protease · In Vivo | Open |
| 7 | 558000 seconds | Comparable | LC-MS/MS · human · Human plasma (Mild Hepatic Function Group) | Dose/window: 0.5 mg · Time: Blood samples were taken to determine the plasma concentration profiles of semaglutide 15 minutes prior to do... · Human plasma protease · In Vivo | Open |
| 8 | 543600 seconds | Comparable | LC-MS/MS · human · Human plasma (Moderate Hepatic Function Group) | Dose/window: 0.5 mg · Time: Blood samples were taken to determine the plasma concentration profiles of semaglutide 15 minutes prior to do... · Human plasma protease · In Vivo | Open |
| 9 | 540000 seconds | Comparable | LC-MS/MS · human · Human plasma (Normal Hepatic Function Group) | Dose/window: 0.5 mg · Time: Blood samples were taken to determine the plasma concentration profiles of semaglutide 15 minutes prior to do... · Human plasma protease · In Vivo | Open |
| 10 | 586800 seconds | Comparable | LC-MS/MS · human · Human plasma (Severe Hepatic Function Group) | Dose/window: 0.5 mg · Time: Blood samples were taken to determine the plasma concentration profiles of semaglutide 15 minutes prior to do... · Human plasma protease · In Vivo | Open |
Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.
Reviewed observations retained without being collapsed into comparable values.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.02667 mL/min/kg | Comparable | Clearance in Gottingen mini pig at 2 nmol/kg, iv · porcine | Route: iv · clearance · CL· Clearance in Gottingen mini pig at 2 nmol/kg, iv · Exact ChEMBL pref name... | Open |
| 2 | ~ 0.04 L/h | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · clearance single · Elimination Semaglutide eliminati... | Open |
| 3 | ~ 0.05 L/h | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · clearance single · Elimination The apparent clearanc... | Open |
| 4 | ~ 0.05 L/h | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · clearance single · Elimination The apparent clearanc... | Open |
Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
PubMed 38952487 | PersistenceStability Half Life, Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 23 identity 23 evidence |
PubMed 29536338 | Stability Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 4 identity 4 evidence |
PubMed 29693715 | Stability Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 4 identity 4 evidence |
PubMed 29623579 | Stability Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 4 identity 4 evidence |
Reference link | DistributionExposurePersistence Area Under Curve, Bioavailability, Clearance, Max Concentration +3 more | No reported alias | 0 identity 8 evidence |
Reference link | DistributionExposurePersistence Area Under Curve, Bioavailability, Clearance, Plasma Protein Binding +2 more | No reported alias | 0 identity 8 evidence |
PubMed 33969456 | Stability Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 3 identity 3 evidence |
PubMed 30041153 | Persistence Half Life | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 3 identity 3 evidence |
Reference link | DistributionExposurePersistence Area Under Curve, Bioavailability, Clearance, Plasma Protein Binding +2 more | No reported alias | 0 identity 6 evidence |
PubMed 38486997 | Stability Serum Plasma Stability | No reported alias H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRGexact | 2 identity 2 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0011948' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
Reported sequence notation was converted to parent-residue display for visualization; the original notation remains shown below.
Features are shown only when a reported notation or topology record supports them.
A lowercase one-letter residue was reported. It is shown as the parent residue here and kept as a reported marker until stereochemistry or modification can be normalized.
Reported token b is not one of the 20 standard residue symbols in this display.
| Confidence |
|---|
| Match |
|---|
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match | experimental | 100.0% identity |
| Open | Sequence match |
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | Observation Similar exposure is achieved with subcutaneous administration of semaglutide in the abdomen, thigh, or upper arm. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Semaglutide· 12.3 Pharmacokinetics · exposure injection site similarity text · Similar ex... | Open |
| 2 | Observation Similar exposure was achieved with subcutaneous administration of semaglutide in the abdomen, thigh, or upper arm. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Semaglutide· 12.3 Pharmacokinetics · exposure injection site similarity text · Similar ex... | Open |
| 3 | Observation Effect of Semaglutide Tablet Formulations : There were no clinically significant differences observed in the mean steady state AUC 0-24h,SS and C max,SS between the 3 mg, 7 mg and 14 mg doses of RYBELSUS and the 1.5 mg, 4 mg and 9 mg doses of OZEMPIC tablets, respectively, in a clinical study conducted in healthy subjects. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · cmax auc formulation similarity text · Effect of Sem... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | Observation Effect of Semaglutide Tablet Formulations : There were no clinically significant differences observed in the mean steady state AUC 0-24h,SS and C max,SS between the 3 mg, 7 mg and 14 mg doses of RYBELSUS and the 1.5 mg, 4 mg and 9 mg doses of OZEMPIC tablets, respectively, in a clinical study conducted in healthy subjects. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · cmax auc formulation similarity text · Effect of Sem... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 1 hour 3600 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: oral · Semaglutide· 12.3 Pharmacokinetics · tmax product maximum concentration reached approxima... | Open |
| 2 | 1 hour 3600 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · tmax maximum concentrations achieved at · Maximum co... | Open |
| 3 | 1-3 days 86400-259200 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · tmax range maximum concentrations achieved · Maximum... | Open |
| 4 | 1-3 days 86400-259200 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Semaglutide· 12.3 Pharmacokinetics · tmax range maximum concentrations achieved · Maximum... | Open |
| 5 | 12 hr 43200 seconds | Comparable | Tmax in Gottingen mini pig at 2 nmol/kg, sc · porcine | Route: sc · time to max concentration · Tmax· Tmax in Gottingen mini pig at 2 nmol/kg, sc · Exact ChE... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 97.8 % | Comparable | Binding affinity to human serum albumin after 60 mins by ultrafiltration-based HPLC analysis · human · serum | plasma protein binding · PPB· Binding affinity to human serum albumin after 60 mins by ul... | Open |
| 2 | 99 % | Comparable | PepTherDia curated product PK field · plasma protein | Route: SC, ORAL · 63 · Semaglutide · exact product name match · field mismatch | Open |
| 3 | > 99 % | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Semaglutide· 12.3 Pharmacokinetics · plasma binding bound to plasma matrix · Semaglutide... | Open |
| 4 | > 99 % | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Semaglutide· 12.3 Pharmacokinetics · plasma binding bound to plasma matrix · Semaglutide... | Open |
| 5 | > 99 % | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Semaglutide· 12.3 Pharmacokinetics · plasma binding percent bound to plasma matrix · Sema... | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 3 Hours 10800 seconds | Comparable | LC-HRMS · human · 1 mg/ml human SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · Human SCT protease · In Vitro | Open |
| 2 | > 4 Hours > 14400 seconds | Comparable | LC-HRMS · porcine · 1 mg/ml göttingen minipigs SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · Göttingen minipigs SCT protease · In Vitro | Open |
| 3 | 0.9 Hours 3240 seconds | Comparable | LC-HRMS · rat · 1 mg/ml SD rats SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · SD rats SCT protease · In Vitro | Open |
| 4 | 156 Hours 561600 seconds | Comparable | LC-MS/MS · human · Human blood sample with once weekly dosage (at steady state) | Route: SC · Dose/window: 0.5 mg · Time: Blood samples for PK assessment of semaglutide were taken at the following time points after the first dose:... · Human blood sample protease · In Vivo | Open |
| 5 | 159 Hours 572400 seconds | Comparable | LC-MS/MS · human · Human blood sample with once weekly dosage (at steady state) | Route: SC · Dose/window: 1 mg · Time: Blood samples for PK assessment of semaglutide were taken at the following time points after the first dose:... · Human blood sample protease · In Vivo | Open |
The identity reference does not expose a sequence string.
H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.
| 100.0% identity |
| Open | Sequence match | experimental | 96.5% identity |
| Open | Sequence match | experimental | 96.5% identity |
| Open | Sequence match | experimental | 96.5% identity |
| Open | Sequence match | experimental | 96.5% identity |
| Open | Sequence match | experimental | 96.4% identity |
| Open | Sequence match | experimental | 96.4% identity |
| Open | Sequence match | experimental | 96.4% identity |