Peptide·plain sequence-like
Lixisenatide
ATLPC0015930
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Routes
- Length44 aa
- Monoisotopic mass
Stack
ATLPC0015930
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Is the peptide identity interpretable at sequence or structure-string level?
Are molecular graph, topology, or 3D coordinates available?
Can basic developability descriptors be computed?
Is this peptide linked to approved or named product context?
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
What safety, toxicity, or tolerability evidence is attached?
Can every measurement be reviewed in one cross-domain table?
Can the peptide identity be checked against reported names, sequence notation, and reference links?
Can this profile view be reproduced from structured records?
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Features are shown only when a reported notation or topology record supports them.
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 444.87 ng*h/L | Comparable | FDA Clinical Pharmacology Review PMR Study TDR14311 Table 7 manual extraction · human · plasma | Route: subcutaneous · Dose/window: 20 mcg repeated dosing; pediatric patients with type 2 diabetes; ADA-negative P... · Time: day 42 | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 56.9 pg/mL | Comparable | EU Clinical Trials Register PKD11475 results manual extraction · human · plasma | Route: subcutaneous · Dose/window: single 10 mcg lixisenatide; adult patients with type 2 diabetes; N=10; sampling... · Time: day 1 | Open |
| 2 | 34.3 pg/mL | Comparable | EU Clinical Trials Register PKD11475 results manual extraction · human · plasma | Route: subcutaneous · Dose/window: single 10 mcg lixisenatide; paediatric patients with type 2 diabetes; N=8; samp... · Time: day 1 | Open |
| 3 | 26 pg/mL | Comparable | EU Clinical Trials Register PKD11475 results manual extraction · human · plasma | Route: subcutaneous · Dose/window: single 5 mcg lixisenatide; adult patients with type 2 diabetes; N=10; sampling... · Time: day 1 | Open |
| 4 | 29.7 pg/mL | Comparable | EU Clinical Trials Register PKD11475 results manual extraction · human · plasma | Route: subcutaneous · Dose/window: single 5 mcg lixisenatide; paediatric patients with type 2 diabetes; N=8; sampl... · Time: day 1 | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 1-3.5 hours 3600-12600 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Lixisenatide· 12.3 Pharmacokinetics · tmax median tmax range is · 12.3 Pharmacokinetics A... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 55 % | Comparable | PepTherDia curated product PK field · plasma protein | Route: SC · 55 · Lixisenatide · exact product name match · exact or normalized match | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | < 0.5 Hours < 1800 seconds | Comparable | LC-HRMS · human · 1 mg/ml human SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · Human SCT protease · In Vitro | Open |
| 2 | < 0.5 Hours < 1800 seconds | Comparable | LC-HRMS · porcine · 1 mg/ml göttingen minipigs SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · Göttingen minipigs SCT protease · In Vitro | Open |
| 3 | < 0.5 Hours < 1800 seconds | Comparable | LC-HRMS · rat · 1 mg/ml SD rats SCT protein | Dose/window: 10 μM · Time: At each time point (0, 0.5, 1, 2, 4 h), 50 μL of SCts were collected from the incubation mixture · SD rats SCT protease · In Vitro | Open |
The identity reference does not expose a sequence string.
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.