Peptide·plain sequence-like

Lixisenatide

ATLPC0015930

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK

Routes

Compare in workbench Download release API JSON

Length
44 aa
Monoisotopic mass
4856.5 Da
Net charge @ pH 7.4
3.10
Isoelectric point
10.33
GRAVY
-1.109

Sequence & molecular identity

1 forms

Reviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.

Sequence & peptidoform

Identity summaryCanonical sequence only

Identity status: Canonical sequence only
Residues: 44
Peptidoform features: 0
Documented molecular forms: 1
Representations: 2

Documented molecular forms1 form linked to this peptide identity

Form	Topology	Modifications	Connections	Representations	Measurements
ATLPF0017463	—	1	—	Notation only	4

Residue view

Residue display

44 residues

H1G2E3G4T5F6T7S8D9L10S11K12Q13M14E15E16E17A18V19R20L21F22I23E24W25L26K27N28G29G30P31S32S33G34A35P36P37S38K39K40K41K42K43K44

Side-chain classNonpolarPolarBasic (+)Acidic (−)Modified

Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.

Peptidoform features

Features are shown only when a reported notation or topology record supports them.

No terminal modification, residue-level marker, disulfide, staple, coordination, or other topology signal is currently available.

Structure & chemistry

Chemical representationsequence / HELM only

Representation class

How the current release can interpret this identity chemically.

plain sequence-like

Parent-residue sequence

Residue string used for positional interpretation when available.

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK

HELM

Polymer notation for modified peptide representation when available.

Not available

SMILES

Chemical graph string used for atom-level 2D depiction when available.

Not available

No atom-level graph

A reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.

3D structure references9 references

Structure reference·

3D coordinates·Sequence matchexperimental

Sequence match·reference selected·identity 100.0%·confidence experimental

Link	Method	Confidence	Match
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	100.0% identity
Open	Sequence match	experimental	97.2% identity
Open	Sequence match	experimental	97.2% identity
Open	Sequence match	experimental	96.5% identity

Covalent topology & modificationsnone

Exact topology not established

No reviewed form-level topology or residue-level connection annotation is attached to this peptide in the current release. This is not evidence that every molecular form is linear or unmodified.

Physicochemical profile

4 descriptors

Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.

Core descriptors44 aa · pI 10.3 · GRAVY -1.11

Length: 44 aa
Monoisotopic mass: 4856.53 Da
Average mass: 4859.53 Da
Net charge at pH 7.4: 3.10
Estimated pI: 10.33
GRAVY: -1.109
KD-positive residues: 22.7%
Aromatic residues: 6.8%

Developability interpretation

Ionization context: pH 7.4 separated from pI
Hydrophobicity balance: Leans hydrophilic
Amphipathic moment (μH): 0.34
Computation boundary: Standard-sequence only

Charge & residue composition

pH charge context

Modeled net charge across common formulation and assay pH checkpoints.

pH 2

10.92

pH 5

4.64

pH 6

3.83

pH 7.4

3.05

pH 9

2.16

pH 12

-5.77

Residue-class composition

Grouped composition is often more interpretable than a long amino-acid list.

Acidic (D,E)

6 · 13.6%

Basic (K,R,H)

10 · 22.7%

Polar uncharged (N,Q,S,T)

9 · 20.5%

Hydrophobic aliphatic (A,V,I,L,M)

8 · 18.2%

Aromatic (F,W,Y)

3 · 6.8%

Conformational / sulfur (G,P,C)

8 · 18.2%

Top residues

K818.2%E511.4%G511.4%S511.4%L36.8%P36.8%A24.5%F24.5%

Hydropathy & amphipathic windows

Hydropathy windows

Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.

Most hydrophobic window

17-23

EAVRLFI

GRAVY 1.300

Most hydrophilic window

38-44

SKKKKKK

GRAVY -3.457

38 local hydropathy windows scanned. A local patch is context for solubility, adsorption, and membrane interaction review, not a standalone endpoint.

Amphipathic-window scan

Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.

12 aa window

17-28

EAVRLFIEWLKN

μH 1.99 · charge 0.0

12 aa window

16-27

EEAVRLFIEWLK

μH 1.87 · charge -1.0

12 aa window

18-29

AVRLFIEWLKNG

μH 1.69 · charge 1.0

15 aa window

17-31

EAVRLFIEWLKNGGP

μH 1.66 · charge 0.0

15 aa window

16-30

EEAVRLFIEWLKNGG

μH 1.61 · charge -1.0

Sequence-liability cues

Sequence-liability notes

Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.

Asn deamidation motif

NG · pos 28

Asn followed by small/polar residues is a known sequence context to review for deamidation susceptibility.

Oxidation-sensitive residues

M, W · pos 14, 25

Met, Trp, and Cys residues can merit formulation review for oxidation or covalent-state sensitivity.

Alpha-helix amphipathic projection

Helical wheel · Edmundson projection

μ_H = 0.34100°/residue · 44 aa

Hydrophobic moment0.34

Mean K-D hydropathy-1.11

Approx. net charge+3

Projection angle100° / residue

The pale sector marks the direction of the hydrophobic face inferred from μ_H. This is a projection assumption, not a measured fold.

HydrophobicAromaticPolarBasic +Acidic −Specialhydrophobic faceμ_H arrow → hydrophobic face

The projection assumes an α-helix conformation; a long μ_H arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.

Method notes

Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.

Computed developability descriptors

Deterministic descriptors computed from the reviewed sequence or chemical structure (RDKit), each anchored to a literature method. These are computed estimates for developability interpretation — not experimental measurements — and are validated against independent reference implementations.

Sequence-derived

Computed from the standard parent-residue sequence; protein-origin metrics defined at any length.

Aliphatic index

46.59

Instability index

53.6

Above 40 — predicted unstable in vitro.

Boman index

2.24 kcal/mol

Molar extinction coefficient (280 nm)

5,500 M⁻¹·cm⁻¹

A280 (1 g/L) ≈ 1.13

Structure-derived descriptors are not shown because this identity has no resolved chemical structure (SMILES). This is a known coverage gap for disulfide-rich and unresolved peptidoforms, not a computation error.

Exposure / Absorption

7 records

What evidence describes systemic exposure or absorption?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeBioavailability AUC Cmax Tmax

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Bioavailability1 record · 1 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	~ 32 %	Eligible when experimental context matches	FDA Clinical Review 4.4.3 pharmacokinetics manual extraction · human · plasma	Result: Approximate quantitative measurement · Molecular form: not reported · Route: subcutaneous · Source: Primary reference linked	Reference

AUC1 record · 1 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	444.87 ng*h/L	Eligible when experimental context matches	FDA Clinical Pharmacology Review PMR Study TDR14311 Table 7 manual extraction · human · plasma	Result: Reported point value · Molecular form: not reported · Route: subcutaneous · Dose/window: 20 mcg repeated dosing; pediatric patients with type 2 diabetes; ADA-negative P... · Time: day 42 · Source: Primary reference linked	Reference

Cmax4 records · 4 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	56.9 pg/mL	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Result: Reported point value · Molecular form: not reported · Route: subcutaneous · Dose/window: single 10 mcg lixisenatide; adult patients with type 2 diabetes; N=10; sampling... · Time: day 1 · Source: Primary reference linked	Reference
2	34.3 pg/mL	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Result: Reported point value · Molecular form: not reported · Route: subcutaneous · Dose/window: single 10 mcg lixisenatide; paediatric patients with type 2 diabetes; N=8; samp... · Time: day 1 · Source: Primary reference linked	Reference
3	26 pg/mL	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Result: Reported point value · Molecular form: not reported · Route: subcutaneous · Dose/window: single 5 mcg lixisenatide; adult patients with type 2 diabetes; N=10; sampling... · Time: day 1 · Source: Primary reference linked	Reference
4	29.7 pg/mL	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Result: Reported point value · Molecular form: not reported · Route: subcutaneous · Dose/window: single 5 mcg lixisenatide; paediatric patients with type 2 diabetes; N=8; sampl... · Time: day 1 · Source: Primary reference linked	Reference

Tmax1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	1-3.5 hours 3600-12600 seconds	Use only explicitly reported fields	human	Result: Interval measurement · Molecular form: not reported · Route: subcutaneous · Lixisenatide· 12.3 Pharmacokinetics · tmax median tmax range is · 12.3 Pharmacokinetics A... · Source: Primary reference linked	Reference

Distribution / Barrier

2 records

What is known about distribution, binding, permeability, or barrier crossing?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopePlasma protein binding Vd

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Vd1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	~ 100 L	Use only explicitly reported fields	human	Result: Approximate quantitative measurement · Molecular form: not reported · Route: subcutaneous · Lixisenatide· 12.3 Pharmacokinetics · volume of distribution single · Distribution The ap... · Source: Primary reference linked	Reference

Plasma protein binding1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	55 %	Use only explicitly reported fields	plasma protein	Result: Reported point value · Molecular form: not reported · Route: SC · 55 · Lixisenatide · exact product name match · exact or normalized match · Source: Primary reference linked	Source record

Barrier and permeability assay context

PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.

PAMPA

artificial membrane

Caco-2

cell monolayer

MDCK

cell monolayer

RRCK

cell monolayer

BBB

barrier evidence

Metabolic & Proteolytic Stability

1 records

How stable is the peptide in biological matrices or protease systems?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeSerum/plasma stability

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Serum/plasma stability1 record · 1 matched-context · 0 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	7.1 Hours 25560 seconds	Eligible when experimental context matches	LC-MS/MS · rat · Rats blood plasma	Result: Reported point value · Molecular form: ATLPF0017463 · Dose/window: 1000 ng/mL · Rats blood plasma protease · In Vitro · Source: Primary reference linked	Reference

Excretion / Persistence

4 records

What evidence describes clearance or persistence?

Evidence records

Complete canonical measurements and observations attached to this domain.

Endpoint scope

Formal ADMET endpoints represented for this peptide.

Matched-context analysis

Quantitative results that may be analysed only with scientifically compatible records.

Reported-result review

Qualitative, narrative, or review-first results interpreted in their source context.

Endpoints in scopeHalf Life Clearance

Evidence interpretation

Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.

Eligible for matched-context analysis

Quantitative results whose endpoint and context must still be matched before analysis.

Interpret as reported

Qualitative, narrative, or review-first findings preserved in source context.

Supporting context only

Reference, label, clinical, or supporting context for interpretation.

Review before analysis

Records whose present structure does not establish a safe analysis role.

Evidence by endpoint

Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.

Clearance1 record · 0 matched-context · 1 as reported · 0 context only · 0 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	35 L/h	Use only explicitly reported fields	human	Result: Reported point value · Molecular form: not reported · Lixisenatide· 12.3 Pharmacokinetics · clearance mean apparent cl f about · After multiple... · Source: Primary reference linked	Reference

Half Life3 records · 0 matched-context · 0 as reported · 0 context only · 3 review required

#	Value	Analysis use	Assay / model	Result context	Reference
1	< 0.5 Hours < 1800 seconds	Review experimental context before comparison	Not specified	Result: Upper-bound measurement · Molecular form: ATLPF0017463 · Source: Primary reference linked	Reference
2	< 0.5 Hours < 1800 seconds	Review experimental context before comparison	Not specified	Result: Upper-bound measurement · Molecular form: ATLPF0017463 · Source: Primary reference linked	Reference
3	< 0.5 Hours < 1800 seconds	Review experimental context before comparison	Not specified	Result: Upper-bound measurement · Molecular form: ATLPF0017463 · Source: Primary reference linked	Reference

Evidence landscape

14 records

Cross-domain evidence distribution and measurement-level detail; the domain modules above show evidence in context, and every row remains available for audit here.

Evidence landscape

A cross-domain view of evidence volume, scientifically permitted analysis use, and source traceability.

ADMET domain

Eligible when context matches

Interpret as reported

Supporting context only

Review before analysis

Exposure / Absorption

7 evidence records

Distribution / Barrier

2 evidence records

Metabolic & Proteolytic Stability

1 evidence record

Excretion / Persistence

4 evidence records

Toxicity / Safety

0 evidence records

Endpoint distribution

Top evidence-bearing endpoint questions.

Max Concentration

Half Life

Area Under Curve

Bioavailability

Clearance

Plasma Protein Binding

Serum Plasma Stability

Time To Max Concentration

Assay context

Broad context buckets, useful before comparing values.

In vivo / route

Unspecified

Matrix / stability

Traceability

Reference-link availability for measurement-level audit.

Linked reference

Not linked

All evidence index

Every evidence record remains available for audit and drilldown. Counts describe evidence volume, not confidence.

DomainAnalysis useReferenceSpeciesMatrix

#	ADMET domain	Endpoint	Reported value	Result type	Analysis use	Assay / model	Condition	Reference
1	Excretion / Persistence Persistence	Half Life	< 0.5 Hours < 1,800 seconds	Upper-bound measurement	Review experimental context before comparison	Not specified	Not specified	Reference Primary reference linked
2	Excretion / Persistence Persistence	Half Life	< 0.5 Hours < 1,800 seconds	Upper-bound measurement	Review experimental context before comparison	Not specified	Not specified	Reference Primary reference linked
3	Excretion / Persistence Persistence	Half Life	< 0.5 Hours < 1,800 seconds	Upper-bound measurement	Review experimental context before comparison	Not specified	Not specified	Reference Primary reference linked
4	Metabolic & Proteolytic Stability Stability	Serum Plasma Stability	7.1 Hours 25,560 seconds	Reported point value	Eligible when experimental context matches	LC-MS/MS · rat · Rats blood plasma	Dose/window: 1000 ng/mL · Protease: Rats blood plasma protease · In Vitro	Reference Primary reference linked
5	Exposure / Absorption Exposure	Bioavailability	~ 32 %	Approximate quantitative measurement	Eligible when experimental context matches	FDA Clinical Review 4.4.3 pharmacokinetics manual extraction · human · plasma	Route: subcutaneous · Adlyxin/lixisenatide NDA 208471 clinical review · highlights of pharmacokinetics for the proposed 10 microgram starting dose and 20 microgram maintenance dose in type...	Reference Primary reference linked
6	Exposure / Absorption Exposure	Area Under Curve	444.87 ng*h/L	Reported point value	Eligible when experimental context matches	FDA Clinical Pharmacology Review PMR Study TDR14311 Table 7 manual extraction · human · plasma	Route: subcutaneous · Time: day 42 · Dose/window: 20 mcg repeated dosing; pediatric patients with type 2 diabetes; ADA-negative PopPK analysis; N=18 · AUC summary statistics were derived fr...	Reference Primary reference linked
7	Exposure / Absorption Exposure	Max Concentration	29.7 pg/mL	Reported point value	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Route: subcutaneous · Time: day 1 · Dose/window: single 5 mcg lixisenatide; paediatric patients with type 2 diabetes; N=8; sampling through 6.5 hours post-dose · EU Clinical Trials Register...	Reference Primary reference linked
8	Exposure / Absorption Exposure	Max Concentration	34.3 pg/mL	Reported point value	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Route: subcutaneous · Time: day 1 · Dose/window: single 10 mcg lixisenatide; paediatric patients with type 2 diabetes; N=8; sampling through 6.5 hours post-dose · EU Clinical Trials Registe...	Reference Primary reference linked
9	Exposure / Absorption Exposure	Max Concentration	26 pg/mL	Reported point value	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Route: subcutaneous · Time: day 1 · Dose/window: single 5 mcg lixisenatide; adult patients with type 2 diabetes; N=10; sampling through 6.5 hours post-dose · EU Clinical Trials Register res...	Reference Primary reference linked
10	Exposure / Absorption Exposure	Max Concentration	56.9 pg/mL	Reported point value	Eligible when experimental context matches	EU Clinical Trials Register PKD11475 results manual extraction · human · plasma	Route: subcutaneous · Time: day 1 · Dose/window: single 10 mcg lixisenatide; adult patients with type 2 diabetes; N=10; sampling through 6.5 hours post-dose · EU Clinical Trials Register re...	Reference Primary reference linked

1–10 / 14

Product context

1 products

Product-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.

Summary1 linked product

Linked products: 1
Label context: None
Clinical trials: 42
Safety label cues: None

Linked products1 shown

Lixisenatide

Peptide-product match

Unique peptide match

Route / product class

subcutaneous · Injection, solution

Clinical context

42 trial records · 7 exact intervention matches · 14 with results · latest 2026-04-08

Label safety context

No label safety cue linked

View product

Identity & reference map

14 sources

Reference-level support for checking reported names, sequence notation, and peptide identity agreement.

Summary7 reference groups

Identity type: canonical sequence
Reported notation: 1
Reference groups: 7
Measurements: 14
ATL peptide ID: ATLPC0015930

Identity concordance

Exact reported notation

Reported sequence string matches the current peptide notation.

0 / 14

Parent-residue compatible

Reported notation differs, but resolves to the same parent-residue display.

0 / 14

Different notation

Reported notation does not resolve to the current display sequence.

1 / 14

Source sequence not captured

No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.

13 / 14

Reported sequence notation

Different1 reference

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Current identity

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK

Reported names

No distinct human-readable aliases are exposed.

Reference map7 reference groups

Reference map

Grouped by reference link, with endpoint scope and reported identity kept visible.

Reference	Supports	Reported identity	Records
Reference Open	Exposure Max Concentration	No reported alias	4 identity 4 evidence
Reference Open	Persistence Half Life	No reported alias	3 identity 3 evidence
Reference Open	DistributionExposurePersistence Clearance, Time To Max Concentration, Volume Of Distribution	No reported alias	3 identity 3 evidence
Reference Open	Stability Serum Plasma Stability	No reported alias	1 identity 1 evidence
Reference Open	Exposure Bioavailability	No reported alias	1 identity 1 evidence
Reference Open	Exposure Area Under Curve	No reported alias	1 identity 1 evidence
Source record Open	Distribution Plasma Protein Binding	No reported alias HGEGTFTSDLSKQMEEEAV...GPSSGAPPSKKKKKK-NH2different	1 identity 1 evidence

Data access & reproducibility

Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.

Record scopePublic release

ATL peptide ID: ATLPC0015930
Identity type: canonical sequence
ADMET endpoints: 9
Evidence records: 14
Reference groups: 7
Release view: Public release

Data access

Structured peptide profile

JSON

Peptide-specific profile used by this page, including identity and evidence context.

Open JSON

Peptide catalogue

TSV

Complete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.

Download catalogue

Measurement catalogue

TSV

Complete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.

Download measurements

Programmatic access

The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.

Open endpoint

GET /api/v1/peptides/ATLPC0015930

open

curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0015930' \
  -H 'accept: application/json' \
  -H 'X-Visibility: public_release'