Liraglutide
ATLPC0024280
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
- Length31 aa
- Monoisotopic mass3381.7 Da
- Net charge @ pH 7.4-0.90
- Isoelectric point5.62
- GRAVY-0.255
- Measurements32
- Endpoints9
- Domains4/5
- Products1
Open the matching evidence section below
Sequence & molecular identity
1 formsReviewed sequence, peptidoform forms, chemical representation, 3D references, and covalent topology used to interpret this peptide identity.
Sequence & peptidoform
A peptidoform is one specific molecular form of the peptide — its sequence plus the modifications at given positions (HUPO-PSI term). This view preserves the reported terminal groups, residue modifications, and stereo markers from the source notation.
Identity summarySpecific molecular form represented
- Identity status
- Specific molecular form represented
- Residues
- 31
- Peptidoform features
- 1
- Documented molecular forms
- 1
- Representations
- 2
Documented molecular forms1 form linked to this peptide identity
| Form | Topology | Modifications | Connections | Representations | Measurements | |
|---|---|---|---|---|---|---|
| ATLPF0026481 | — | 2 | — | 1 | 20 |
Residue view
Soft tints mark standard side-chain classes for scanning. Primary emphasis is reserved for reported modifications, termini, secondary-structure tracks, and topology links.
Features are shown only when a reported notation or topology record supports them.
Inline modification γ-Glu-palmitoyl is reported on parent residue K20.
Reported sequence notation was converted to parent-residue display for visualization; the original notation remains shown below.
Structure & chemistry
Chemical representationsequence / HELM only
How the current release can interpret this identity chemically.
modified or textualResidue string used for positional interpretation when available.
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
3D structure referencesnone attached
A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.
Covalent topology & modifications1 signal
| Feature | Positions | Interpretation | Link |
|---|---|---|---|
| Form-level topology | ATLPF0026481 | Open-chain form. Residue-level connection endpoints are shown separately when available. | Not linked |
Physicochemical profile
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity. Computed values are interpretation aids, not experimental ADMET measurements.
Core descriptors31 aa · pI 5.6 · GRAVY -0.26
- Length
- 31 aa
- Monoisotopic mass
- 3381.67 Da
- Average mass
- 3383.72 Da
- Net charge at pH 7.4
- -0.90
- Estimated pI
- 5.62
- GRAVY
- -0.255
- KD-positive residues
- 35.5%
- Aromatic residues
- 12.9%
Developability interpretation
- Ionization context
- pH 7.4 separated from pI
- Hydrophobicity balance
- Leans hydrophilic
- Amphipathic moment (μH)
- 0.10
- Computation boundary
- Standard-sequence only
Charge & residue composition
Modeled net charge across common formulation and assay pH checkpoints.
Grouped composition is often more interpretable than a long amino-acid list.
Hydropathy & amphipathic windows
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Sequence-liability cues
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Alpha-helix amphipathic projection
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
Method notes
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
Exposure / Absorption
16 recordsWhat evidence describes systemic exposure or absorption?
Distribution / Barrier
10 recordsWhat is known about distribution, binding, permeability, or barrier crossing?
Barrier and permeability assay context
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
cell monolayer
barrier evidence
Metabolic & Proteolytic Stability
1 recordsHow stable is the peptide in biological matrices or protease systems?
Evidence interpretation
Result type, analysis use, and source-check status are kept separate so a numerical value is not mistaken for a universally comparable result.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
Serum/plasma stability1 record · 1 matched-context · 0 as reported · 0 context only · 0 review required
| # | Value | Analysis use | Assay / model | Result context | Reference |
|---|---|---|---|---|---|
| 1 | 17.1 hours 61560.00000000001 seconds | Eligible when experimental context matches | LC-MS/MS · rat · Rat Plasma | Result: Reported point value · Molecular form: ATLPF0026481 · Dose/window: 1000ng/ml · Rat plasma proteases · in vitro · Source: Primary reference linked | Reference |
Excretion / Persistence
5 recordsWhat evidence describes clearance or persistence?
Evidence landscape
32 recordsCross-domain evidence distribution and measurement-level detail. 20 of 32 evidence records are included in the profile preview; the full index is loaded below.
Product context
1 productsProduct-level route, label, and clinical context that frames peptide-level evidence. A peptide-level summary only; product pages keep the full drilldown.
Summary1 linked product
- Linked products
- 1
- Label context
- 1
- Clinical trials
- 45
- Safety label cues
- None
Linked products1 shown
Liraglutide
Identity & reference map
32 sourcesReference-level support for checking reported names, sequence notation, and peptide identity agreement.
Summary8 reference groups
- Identity type
- reported modified sequence
- Reported notation
- 1
- Reference groups
- 8
- Measurements
- 32
- ATL peptide ID
- ATLPC0024280
Identity concordance
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
No source-specific sequence was captured for comparison; this is not interpreted as agreement or disagreement.
HAEGTFTSDVSSYLEGQAAK(EX)EFIAWLVRGRG
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
Reference map8 reference groups
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
Reference | Exposure Area Under Curve, Bioavailability, Max Concentration, Time To Max Concentration | No reported alias | 12 identity 6 evidence |
Reference | DistributionPersistence Clearance, Volume Of Distribution | No reported alias | 4 identity 4 evidence |
Reference | Exposure Area Under Curve, Max Concentration, Time To Max Concentration | No reported alias | 3 identity 3 evidence |
Reference | DistributionExposure Bioavailability, Time To Max Concentration, Volume Of Distribution | No reported alias | 3 identity 3 evidence |
Reference | Identity only | No reported alias | 6 identity 0 evidence |
Source record | DistributionExposure Bioavailability, Plasma Protein Binding | No reported alias HAEGTFTSDVSSYLEGQAAK(EX)EFIAWLVRGRGparent-compatible | 2 identity 2 evidence |
Reference | Persistence Half Life | No reported alias | 1 identity 1 evidence |
Reference | Stability Serum Plasma Stability | No reported alias | 1 identity 1 evidence |
Data access & reproducibility
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Record scopePublic release
- ATL peptide ID
- ATLPC0024280
- Identity type
- reported modified sequence
- ADMET endpoints
- 9
- Evidence records
- 32
- Reference groups
- 8
- Release view
- Public release
Data access
Structured peptide profile
JSONPeptide-specific profile used by this page, including identity and evidence context.
Peptide catalogue
TSVComplete frozen peptide table. Filter the ATL peptide ID column locally to isolate this record.
Measurement catalogue
TSVComplete frozen measurement table. Join or filter by ATL peptide ID for peptide-level analysis.
Programmatic access
The request returns the same structured peptide record used by this profile. The tabular downloads are complete frozen release tables and should be filtered locally by ATL peptide ID.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0024280' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'