Peptide·modified or textual
Liraglutide
ATLPC0024280
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
Routes
- Length31 aa
- Monoisotopic mass
ATLPC0024280
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
Reviewed sequence, HELM, or SMILES representation used to interpret this peptide identity.
Molecular graph, chemical representation, 3D references, and covalent topology when available.
Computed sequence-derived descriptors and any measured physicochemical evidence such as lipophilicity.
Product-level route, label, and clinical context that frames peptide-level evidence.
What evidence describes systemic exposure or absorption?
What is known about distribution, binding, permeability, or barrier crossing?
How stable is the peptide in biological matrices or protease systems?
What evidence describes clearance or persistence?
Cross-domain evidence distribution, traceability, and measurement-level detail for this peptide.
Reference-level support for checking reported names, sequence notation, and peptide identity agreement.
Stable record access, analysis-ready files, and scripted retrieval for reproducing this profile view.
Are molecular graph, topology, or 3D coordinates available?
What safety, toxicity, or tolerability evidence is attached?
Normalized for positional visualization, not a replacement for the reported modified notation.
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Original notation retained for interpretation and comparison.
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
Interpretation: Evidence should be compared across compatible peptide identities and peptidoforms. A sequence-only match may not be equivalent when terminal modifications, stereochemistry, cyclization, or cross-links differ.
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPolymer notation for modified peptide representation when available.
Not availableChemical graph string used for atom-level 2D depiction when available.
Not availableA reviewed SMILES is required before a 2D molecular depiction can be shown. Sequence and HELM remain useful for identity interpretation, but they do not replace a chemical graph.
A 3D structure isn't available for this peptide in the current release. Chemistry and topology fields remain available when represented by sequence, HELM, or SMILES.
No disulfide, staple, coordination, other cross-link, or residue-level modification annotation is attached to this peptide in the current release.
Interpretation: A 2D graph describes connectivity, not conformation. A 3D reference describes one coordinate model or solved state, not the full ensemble. ADMET interpretation should account for peptidoform, topology, and assay context together.
Modeled net charge across common formulation and assay pH checkpoints.
Seven-residue sliding windows expose local patches hidden by whole-sequence GRAVY.
Top alpha-helix hydrophobic-moment windows across 12, 15, 18, and 21 residues.
Motifs are review prompts for formulation or CMC interpretation; they are not degradation predictions.
Charge model: side-chain pKa D 3.9, E 4.1, C 8.5, Y 10.1, H 6.5, K 10.8, R 12.5 with EMBOSS termini. pI is estimated by binary search on modeled net charge. Hydropathy uses Kyte-Doolittle values; hydrophobic moment follows the Eisenberg alpha-helix vector-sum convention. When the basis is a parent-residue sequence, modified chemistry is intentionally not inferred.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Bioavailability, AUC, Cmax, and Tmax evidence.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 66 % | Comparable | Bioavailability in Gottingen mini pig at 1 nmol/kg, sc · porcine | Route: sc · bioavailability · F· Bioavailability in Gottingen mini pig at 1 nmol/kg, sc · Exact ChEMB... | Open |
| 2 | ~ 55 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · bioavailability single percent · Absolute bioavailab... | Open |
| 3 | ~ 55 % | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · bioavailability single percent · Absolute bioavailab... | Open |
| 4 | 55 % | Comparable | PepTherDia curated product PK field | Route: SC · 16 · Liraglutide · exact product name match · field mismatch | Open |
Interpretation: Exposure and absorption values should be compared only within matching route, dose, matrix, population, and unit context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Distribution volume, plasma protein binding, permeability, and BBB penetration evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.0674 L/kg | Comparable | Apparent volume of distribution in Gottingen mini pig at 0.5 nmol/kg, iv · porcine | Route: iv · volume of distribution · Vd· Apparent volume of distribution in Gottingen mini pig at 0.5... | Open |
| 2 | 0.07 L/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: intravenous · Liraglutide· 12.3 Pharmacokinetics · volume of distribution single · The mean volume of d... | Open |
| 3 | 0.07 L/kg | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: intravenous · Liraglutide· 12.3 Pharmacokinetics · volume of distribution single · The mean volume of d... | Open |
| 4 | ~ 13 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · volume of distribution apparent sc single · Distribu... | Open |
| 5 | 20-25 L | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · volume of distribution range · Distribution - The me... | Open |
| 6 | 0.07 L/kg | Comparable | THPdb curated therapeutic product PK entry | Route: Subcutaneous · Th1124 · Liraglutide · single value · Subcutaneous · N.A. · 1 · 1576 · US6268343 · 2001-0... | Open |
| 7 | 0.07 L/kg | Comparable | THPdb curated therapeutic product PK entry | Th1124 · Liraglutide · single value · N.A. · N.A. · 5 · 1578|1579|1580|1581|1582 · N.A. | Open |
PAMPA, Caco-2, MDCK/RRCK, and BBB findings are assay/model contexts under Distribution / Barrier. They should not be read as interchangeable measurements.
artificial membrane
cell monolayer
cell monolayer
Interpretation: Distribution, protein binding, PAMPA, cell-monolayer, and BBB evidence are not interchangeable without matching assay/model context.
Reviewed observations retained without being collapsed into comparable values.
Endpoints define the scientific questions in this domain; the measurements below carry the values and assay context.
Serum/plasma stability and protease stability evidence.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 17.1 hours 61560.00000000001 seconds | Comparable | LC-MS/MS · rat · Rat Plasma | Dose/window: 1000ng/ml · Time: 37 °C for 2-72 hours · Rat plasma proteases · in vitro | Open |
| 2 | Observation 14 .9 ±0.9 | Reported | LC-MS/MS · rat · Rat Plasma | Dose/window: 1000ng/ml · Time: 37 °C for 2-72 hours · Rat plasma proteases · in vivo | Open |
Interpretation: In vitro stability, protease stability, and percent-remaining measurements are not collapsed into one value.
Reviewed observations retained without being collapsed into comparable values.
The same three research-facing layers are used across ADMETatlas.
Rows are grouped by endpoint so value, assay context, interpretation layer, and reference can be checked in place.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 0.9-1.4 L/h | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · clearance range direct · The mean apparent clearance... | Open |
| 2 | ~ 1.2 L/h | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · clearance single · Elimination The mean apparent cle... | Open |
| 3 | 1.2 L/h | Comparable | THPdb curated therapeutic product PK entry | Route: Subcutaneous · Th1124 · Liraglutide · single value · Subcutaneous · N.A. · 1 · 1576 · US6268343 · 2001-0... | Open |
| 4 | 1.2 L/h | Comparable | THPdb curated therapeutic product PK entry | Th1124 · Liraglutide · single value · N.A. · N.A. · 5 · 1578|1579|1580|1581|1582 · N.A. | Open |
Interpretation: Clearance and half-life require route, matrix, species/population, and time-scale context before comparison.
Reported sequence string matches the current peptide notation.
Reported notation differs, but resolves to the same parent-residue display.
Reported notation does not resolve to the current display sequence.
Grouped by reference link, with endpoint scope and reported identity kept visible.
| Reference | Supports | Reported identity | Records |
|---|---|---|---|
Reference link | DistributionExposurePersistence Area Under Curve, Bioavailability, Clearance, Max Concentration +3 more | No reported alias | 0 identity 12 evidence |
Reference link | DistributionExposurePersistence Bioavailability, Clearance, Plasma Protein Binding, Time To Max Concentration +1 more | No reported alias | 0 identity 6 evidence |
Reference link | DistributionPersistence Clearance, Volume Of Distribution | No reported alias HAEGTFTSDVSSYLEGQAA...lmitoyl)EFIAWLVRGRGexact | 1 identity 4 evidence |
PubMed 25039358 | Stability Serum Plasma Stability | No reported alias HAEGTFTSDVSSYLEGQAA...lmitoyl)EFIAWLVRGRGexact | 2 identity 2 evidence |
PubMed 24308627 | Exposure Area Under Curve, Max Concentration, Time To Max Concentration | No reported alias | 0 identity 3 evidence |
PubMed 26308095 | DistributionExposure Bioavailability, Time To Max Concentration, Volume Of Distribution | No reported alias | 0 identity 3 evidence |
PubMed 25625650 | Persistence Half Life | No reported alias HAEGTFTSDVSSYLEGQAA...lmitoyl)EFIAWLVRGRGexact | 1 identity 1 evidence |
Reference link | DistributionExposure Bioavailability, Plasma Protein Binding | No reported alias | 0 identity 2 evidence |
Interpretation: Reference links and reported notations help confirm that measurements point to the same peptide identity or a compatible peptidoform. ADMET interpretation still belongs to the endpoint modules above, where assay/model and condition context are shown with each measurement.
Identity, sequence, profile-level fields, and current release view metadata.
The request returns the same structured peptide record used by this profile. Measurement downloads use the same peptide identifier and public release visibility.
curl -sS 'https://admetatlas.scbdd.com/api/v1/peptides/ATLPC0024280' \
-H 'accept: application/json' \
-H 'X-Visibility: public_release'Interpretation: Use these files as the reproducible data package for this peptide profile. Cross-peptide comparison still depends on compatible endpoints, assays, species or model systems, route, dose, matrix, and evidence layer.
Reported sequence notation was converted to parent-residue display for visualization; the original notation remains shown below.
Features are shown only when a reported notation or topology record supports them.
Inline modification γ-Glu-palmitoyl is reported on parent residue K20.
Grouped composition is often more interpretable than a long amino-acid list.
The projection assumes an α-helix conformation; a long μH arrow indicates an amphipathic helix, common in antimicrobial peptides.Sequence > 30 aa — only termini and every fifth position are numbered because later turns share earlier wheel angles.
The same three research-facing layers are used across ADMETatlas.
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 18073.59 ng*h/mL | Comparable | AUC (0 to infinity) in Sprague-Dawley rat at 15 nmol/kg, sc by LC-MS/MS analysis · rat | Route: sc · area under curve · AUC· AUC (0 to infinity) in Sprague-Dawley rat at 15 nmol/kg, sc by LC... | Open |
| 2 | 960 ng*h/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · cmax auc exposures respectively auc · The mean peak... | Open |
| 3 | Observation AUC 0-∞ from thigh was 22% lower than that from abdomen. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Liraglutide· 12.3 Pharmacokinetics · auc injection site difference text · AUC 0-∞ from th... | Open |
| 4 | Observation AUC 0-∞ was equivalent between upper arm and abdomen, and between upper arm and thigh. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Liraglutide· 12.3 Pharmacokinetics · auc injection site equivalence text · AUC 0-∞ was eq... | Open |
| 5 | Observation After subcutaneous single dose administrations, C max and AUC of liraglutide increased proportionally over the therapeutic dose range of 0.6 mg to 1.8 mg. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · cmax auc dose proportionality text · After subcutane... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 240.43 nM | Comparable | Cmax in Sprague-Dawley rat at 15 nmol/kg, sc by LC-MS/MS analysis · rat | Route: sc · max concentration · Cmax· Cmax in Sprague-Dawley rat at 15 nmol/kg, sc by LC-MS/MS analys... | Open |
| 2 | 35 ng/mL | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · cmax auc exposures respectively cmax · The mean peak... | Open |
| 3 | Observation After subcutaneous single dose administrations, C max and AUC of liraglutide increased proportionally over the therapeutic dose range of 0.6 mg to 1.8 mg. | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · cmax auc dose proportionality text · After subcutane... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 11 hours 39600 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · tmax maximum concentrations achieved at · 12.3 Pharm... | Open |
| 2 | 8-12 hours 28800-43200 seconds | Comparable | DailyMed SPL 12.3 Pharmacokinetics label extraction · human | Route: subcutaneous · Liraglutide· 12.3 Pharmacokinetics · tmax range maximum concentrations achieved · 12.3 Ph... | Open |
| 3 | 7 hr 25200 seconds | Comparable | Tmax in Gottingen mini pig at 1 nmol/kg, sc · porcine | Route: sc · time to max concentration · Tmax· Tmax in Gottingen mini pig at 1 nmol/kg, sc · Exact ChE... | Open |
| 4 | 1.51 hr 5436 seconds | Comparable | Tmax in Sprague-Dawley rat at 15 nmol/kg, sc by LC-MS/MS analysis · rat | Route: sc · time to max concentration · Tmax· Tmax in Sprague-Dawley rat at 15 nmol/kg, sc by LC-MS/M... | Open |
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | > 98 % | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Liraglutide· 12.3 Pharmacokinetics · plasma binding bound to plasma matrix · Liraglutide... | Open |
| 2 | > 98 % | Reported | DailyMed SPL 12.3 Pharmacokinetics label extraction · human · plasma | Liraglutide· 12.3 Pharmacokinetics · plasma binding bound to plasma matrix · Liraglutide... | Open |
| 3 | > 98 % | Reported | PepTherDia curated product PK field · plasma protein | Route: SC · 16 · Liraglutide · exact product name match · field mismatch | Open |
cell monolayer
barrier evidence
| # | Value | Evidence layer | Assay / model | Condition | Reference |
|---|---|---|---|---|---|
| 1 | 12 ±2.8 hours 43200 seconds | Comparable | ELISA · Healthy cat blood (Dose s/c injected) | Dose/window: 0.6mg s/c injected · Time: 0.25-84 hours · Cat blood proteases · in vivo | Open |
The identity reference does not expose a sequence string.
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl)EFIAWLVRGRG
Endpoint-level measurements attached to this peptide, suitable for review or reanalysis.
Nested peptide record for scripted retrieval, including identity and evidence context.